(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE391

CP000124.PE391       Location/Qualifiers
FT   CDS_pept        414236..415279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0400"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50117"
FT                   /db_xref="GOA:Q3JX89"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX89"
FT                   /protein_id="ABA50117.1"
FT                   /translation="MAYEAASERYADMQYRVSGKSGLKLPALSLGLWHNFGDTTPISTQ
FT                   REILRTAFDLGITHFDLANNYGPPYGSAETNFGRLLREDFKPYRDELLISTKAGWDMWP
FT                   GPYGSGGGSRKYVLASLDQSLRRMGLDYVDIFYSHRFDAHTPLEETASALASAVQQGKA
FT                   LYVGVSSYSAASTREIAKLLAEYKVPLLIHQPAYNMLNRWIERELLDALDETGSGCIAF
FT                   TPLAQGLLTSKYLNGVPADARINKPGGGSLKEAHLSAENLEHVRKLNEIAQRRGQSLAQ
FT                   MALAWVLRDSRVTSALIGASRAEQVRENVAALAHLAFSDDEIAEIDRYATEGGINLWEK
FT                   PSTDQAI"
     atggcctacg aagcagcttc agaacgctat gcggacatgc agtatcgcgt gagcggcaaa        60
     tccgggctca aattgccggc gctttcgctc ggcttgtggc acaacttcgg cgacacgacg       120
     ccgatctcga cgcagcgcga gatcctgcgc accgcattcg atctcggcat cacgcacttc       180
     gatctcgcga acaactacgg gccgccgtac ggcagcgccg aaacgaactt cggccggctg       240
     ctgcgcgagg atttcaagcc gtatcgcgac gagctgctga tttcgacgaa agccggctgg       300
     gacatgtggc ccggcccgta cggcagcggc ggcggctcgc gcaagtacgt gctcgcgagc       360
     ctcgaccaga gcttgcggcg catggggctc gactatgtcg acatcttcta ttcgcaccgc       420
     ttcgacgcgc acacgccgct cgaggaaacc gcgagcgcgc tcgcgagcgc cgtgcagcag       480
     ggcaaggcgc tctacgtcgg ggtctcgtcg tattcggcgg cgagcacgcg cgagatcgcg       540
     aagctgctcg ccgaatacaa ggtgccgctg ctgatccacc agcccgcgta caacatgctc       600
     aaccgctgga tcgagcgcga gctgctcgac gcgctcgacg agacgggctc gggctgcatc       660
     gcgttcacgc cgctcgcgca ggggcttctg acctcgaagt atctgaacgg cgtgccggcg       720
     gatgcgcgga tcaacaagcc gggcggcgga tcgctgaagg aagctcacct gagcgcggag       780
     aacctcgagc acgtgcgcaa gctgaacgag atcgcgcagc ggcgcggcca gagcctcgcg       840
     cagatggcgc ttgcctgggt gctgcgcgat tcgcgcgtca cgtccgcgtt gatcggtgcg       900
     agccgcgcgg agcaggtgcg cgagaacgtc gcggcgctcg cccatctcgc gttcagcgac       960
     gacgagatcg ccgagatcga ccgctatgcg accgaaggcg ggatcaatct gtgggaaaag      1020
     ccgtccaccg atcaggcgat ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page