(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE392

CP000124.PE392       Location/Qualifiers
FT   CDS_pept        complement(415366..415551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0401"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50788"
FT                   /db_xref="GOA:Q3JX88"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX88"
FT                   /protein_id="ABA50788.1"
FT                   /translation="MSTYFTIADFILLIPMALAGALFLGAVPCATEFRHNVLRVLGAML
FT                   GVAVAVLLVEGLPALI"
     atgtcgacct atttcacgat cgccgacttc atcctgttga tcccgatggc gctcgccggc        60
     gcgctgttcc tcggcgcggt gccgtgcgcg accgagttcc gccacaacgt gctgcgcgtg       120
     ctcggcgcga tgctcggcgt ggcggtcgcc gtgctgctgg tcgaagggct gcccgcgctg       180
     atctag                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page