(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE393

CP000124.PE393       Location/Qualifiers
FT   CDS_pept        complement(415819..416682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0402"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48037"
FT                   /db_xref="GOA:Q3JX87"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX87"
FT                   /protein_id="ABA48037.1"
FT                   /translation="MASVRPALAAHGATSLFVLLWSSGAIFAELGLRHASAFAFLIARF
FT                   ALASLVLLVLSLARRRWLPPRGARRATLATGVLLTGGYSILYLLALERGLAPGILATIL
FT                   GVQPILTLAVLERRMSPARLAGLALALTGLSLVVYRSAAGGAAPAAGTACALGALLAIT
FT                   AGALLQKRVRAAPIDVLPLQNALGLALCALIAPFEPISFEASWAFALPLAWLGIVISVF
FT                   AQLLFYRLMQRGDLVNVTSLFYLVPVVTALMDAAWLGNRLAPLEIAGMIAILAGLALAF
FT                   RRAARD"
     atggcttcag tcagacccgc gctcgccgcg catggggcga cgtcgctttt cgtgctgcta        60
     tggagcagcg gagcgatctt cgccgaactc ggcctgcggc atgcgtccgc attcgctttc       120
     ctgatcgcgc gcttcgcgct cgcatcgctc gtgctgctcg tgctgtcgct cgcgcgccgc       180
     cgctggctgc cgccgcgcgg cgcgcgccgc gcgacgctcg caaccggcgt gctgctcacg       240
     ggcggctatt cgattctgta tctgctcgcg ctcgagcgcg ggctcgcgcc cggcatcctc       300
     gcgaccatac tcggcgtgca gccgatcctc acgctcgccg tgctcgaacg ccgcatgtcg       360
     cccgcgcggc ttgccggcct cgcgctcgcg ctgaccggcc tgagcctcgt cgtctatcgc       420
     agcgccgcgg gcggcgcggc accggcggcg ggcaccgcgt gcgcgctcgg cgcgctgctc       480
     gcgatcacgg cgggcgcgct gctgcaaaaa cgcgtgcgcg ccgcgccgat cgacgtgctc       540
     ccgctgcaga acgcgctcgg ccttgcactg tgcgcgctga tcgccccgtt cgagccgatc       600
     tcgttcgaag cgagctgggc gttcgcgctg ccgctcgcct ggctcggcat cgtgatctcc       660
     gtgttcgcgc agttgctgtt ctaccggctg atgcagcgcg gcgatctcgt caacgtaacg       720
     agcctgttct atctcgtgcc ggtcgtgacc gcgctgatgg acgccgcgtg gctcggcaac       780
     cgtctcgcgc cgctggaaat cgccggcatg atcgcgatcc tcgcaggcct cgcgctcgcg       840
     ttccggcgcg ccgcgcgcga ttga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page