(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE396

CP000124.PE396       Location/Qualifiers
FT   CDS_pept        418906..419946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0405"
FT                   /product="Phosphotransferase enzyme family domain protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50810"
FT                   /db_xref="GOA:Q3JX84"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX84"
FT                   /protein_id="ABA50810.1"
FT                   /translation="MRSMNDATSESNAAGACAGLPFAGLTPERVLDALDSVLIPAGSRT
FT                   DGRLLALNSYENRVYQAGIEDGAPIVAKFYRPQRWSNDAILEEHTFVAELAAREIPAVP
FT                   PLAFDGRTLHEFDGFRFAIFERRGGRAPELDRRDTLEWLGRFIGRIHAVGATKPYAARP
FT                   TLDLRTFGYEPRDFLMSHDFVPDDVRPAYEAAVALALEGVERAYERAGDVRMLRAHGDC
FT                   HPSNVLWTDAGPHFVDFDDSRMAPAVQDLWLLLPGDRPGASRALTDLLAGYEDFCEFDP
FT                   RELHLIEALRTLRLIHYAAWLARRWDDPAFPAAFPWFNTHRYWEARVLELREQIGAMQE
FT                   GPLWPV"
     atgcggagca tgaacgacgc cacttccgaa tccaacgcag ccggcgcttg cgccggcttg        60
     ccttttgcag ggctcacgcc ggagcgcgtg ctcgacgcac tcgacagcgt gctgattccc       120
     gccggttcgc gcaccgacgg gcgcctgctc gcgctcaaca gctacgaaaa ccgcgtctat       180
     caggcaggca tcgaggacgg cgcgccgatc gtcgcgaaat tctatcgtcc gcagcgctgg       240
     tcgaacgacg cgatcctcga agagcatacg ttcgtcgccg agctggccgc gcgcgagatt       300
     ccggccgtgc cgccgctcgc cttcgacggc cgcaccctgc acgaattcga cggttttcgc       360
     ttcgcgatct tcgagcggcg cggcgggcgc gcgccggagc tcgaccggcg cgatacgctc       420
     gaatggctcg gccgcttcat cgggcgcatt cacgcggtcg gcgcgaccaa gccgtacgcc       480
     gcgcggccga cgctcgacct ccgcacgttc ggctacgagc cgcgcgattt cctgatgtcg       540
     cacgacttcg tgccggacga cgttcggcct gcttacgaag cggcggtcgc gcttgcgctg       600
     gaaggcgtcg agcgcgcgta cgagcgcgcg ggcgacgtgc ggatgctgcg cgcgcatggc       660
     gactgccatc cgagcaacgt gctgtggacc gacgcgggcc cgcacttcgt cgatttcgac       720
     gacagccgga tggcgcccgc cgtgcaggat ctgtggctgc tcctgcccgg agaccggccg       780
     ggcgcgtcgc gcgcgctcac cgatctgctc gcgggctacg aggacttctg cgaattcgat       840
     ccgcgcgagc tgcatctgat cgaggcgctg cgcacgctgc ggctcatcca ttacgcggcg       900
     tggctcgcgc gccgctggga cgatcccgcg ttccccgccg cgtttccgtg gttcaacacg       960
     catcgctatt gggaagcgcg cgtgctcgaa ttgcgcgagc agatcggcgc gatgcaggaa      1020
     gggccgttgt ggcccgtgtg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page