(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE398

CP000124.PE398       Location/Qualifiers
FT   CDS_pept        complement(420229..420498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0406"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48321"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX82"
FT                   /protein_id="ABA48321.1"
FT                   /translation="MLGRRARRRSTARAAGRRATGGQPAGGADEGAAASGRASMLHVEG
FT                   VVYRSVCATPARPVELTLAYRQDNDNPLFGAPKDVPRKSLTASR"
     atgctcgggc gccgcgctcg acggcgctcg acggcgcgcg cggccgggcg tcgggcaacc        60
     ggcgggcagc cggcgggcgg cgcggacgaa ggcgcggcgg catccggccg cgcgtcgatg       120
     ctgcacgtcg aaggggtcgt ctaccgatcg gtgtgcgcga cgccggccag gcccgtcgag       180
     ctgacgctcg cgtatcgcca ggacaacgac aatccgttat tcggcgcgcc gaaggacgtg       240
     ccgcgcaaat cgctgacggc gagccgttga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page