(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE40

CP000124.PE40        Location/Qualifiers
FT   CDS_pept        48682..49140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0046"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47733"
FT                   /db_xref="GOA:Q3JY90"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY90"
FT                   /protein_id="ABA47733.1"
FT                   /translation="MTLDTFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIKDMEQ
FT                   SGVIQRYTALLDREKLGLHICALAHVHLTRHNEGGVEQFEREIATCPEVTECYSTTGEA
FT                   DYILKIVAPDIKAYDIFLHERIFKIPAVSQVRTSVVLREIKFDTQLPL"
     gtgaccctcg ataccttttc gcaaaaaatc cttcgcctgt tgcagctcga cgcgcgccgc        60
     tccgtgcagg agatctccga tcaggtcggc ctctccagca cgccgtgctg gcgccgcatc       120
     aaggacatgg agcagtccgg cgtgatccag cgctacaccg cgctgctcga ccgcgagaag       180
     ctcgggctcc atatctgcgc gctcgcgcac gtccacctga cccggcacaa cgaaggcggc       240
     gtcgagcagt tcgagcggga gatcgcgacc tgccccgagg tgaccgagtg ctacagcacg       300
     acgggcgaag ccgattacat cctcaagatc gtcgcgccgg acatcaaggc ttacgacatc       360
     ttcctgcacg aacggatctt caagattccc gccgtctcgc aagtccgcac gagcgtcgtg       420
     ctgcgcgaga tcaagttcga cacgcagttg ccgctctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page