(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE401

CP000124.PE401       Location/Qualifiers
FT   CDS_pept        complement(422000..423679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="BURPS1710b_0410"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47753"
FT                   /db_xref="GOA:Q3JX79"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX79"
FT                   /protein_id="ABA47753.1"
FT                   /translation="MQQDLMTATHRVTNQAPPLSDYNAFETDAALVEAVRRYGASWRQT
FT                   ALSHDGAALTAPDVLALAELANRHAPELETHSPRGERIDALEFHPSWHQLLARLRAEGL
FT                   HALPFSDPRPGAMAARCAGYFLHAQLESGSLCPLTMTFASIPVLQREPALFATLRDKLY
FT                   AREHDARDAPLPQKRSMMVGMGMTEKQGGSDVRSNETHAYPLGAGGRGQAYRLVGHKWF
FT                   FSAPQCDAHLVLARTAEQAGISCFYVPRFSPDGSKNAVHVQRLKDKLGNRSNASSEVEF
FT                   LNAYGVMIGDEGRGVPTIIEMANYTRLDCVIGSAALMRAALVQAIHHARHRSAFGRLLA
FT                   DQPLMRNVLADLALESEAATVLFMRLAHAFEEDAAARSPQARGWRRIVTPAAKFWVCKR
FT                   TLEFTGEAMEVWGGNGYVETGPMARFYREAPVNSIWEGSGNVMCIDVLRAIEREPDAAA
FT                   ALFDEWRDAARHSAPLAGALAELTRLLSLEPEPREACARRIAQRIALVAQASLLLRDGP
FT                   YAVAQAFVATRFGHDSSETGRVFGTLPATIDHAALVERAFPA"
     atgcagcagg acctgatgac ggcgacgcac cgggtgacga accaggcgcc gccgctttcc        60
     gattacaacg cgtttgaaac cgatgccgcg ctcgtcgagg ccgttcgacg gtacggcgcg       120
     agctggcgtc aaacggcgct ctcgcacgac ggcgccgcgc tgacggcgcc cgatgtgctc       180
     gcgctcgccg aactcgcgaa ccggcacgca cccgagctcg agacgcacag cccgcgcggc       240
     gagcggatcg acgcactcga attccacccg agctggcacc agttgcttgc ccggttgcgc       300
     gccgaagggc tgcacgcgct gccgttctcg gacccgcggc cgggcgcgat ggccgcgcgc       360
     tgcgccggct atttcctgca cgcgcagctc gaatccggct cgctctgccc gctcacgatg       420
     acgttcgcga gcattccggt gctgcaacga gaaccggccc tctttgcgac gctgcgcgac       480
     aagctctatg cacgcgagca cgacgcgcgc gatgcgccgc tgccgcaaaa acgctcgatg       540
     atggtcggca tgggcatgac cgaaaagcag ggcggctccg acgtgcgcag caacgagacg       600
     cacgcgtacc cgctcggcgc gggcgggcgc gggcaggcgt accggctcgt cggccacaaa       660
     tggttcttct ccgcgccgca gtgcgacgcg catctcgtgc tcgcgcgcac cgccgagcaa       720
     gcgggcatct catgcttcta cgtgccgcgc ttctcgcccg acggcagcaa gaacgcggtg       780
     cacgtgcaac gcctgaagga caagctcggc aaccgctcga atgcgagcag cgaagtcgaa       840
     ttcctgaacg catacggcgt gatgatcggc gacgaagggc gcggcgtgcc gacgatcatc       900
     gagatggcga actacacgcg gctcgattgc gtgatcggca gcgccgcgct gatgcgcgcg       960
     gcgctcgtgc aggcgattca ccacgcgcgg catcgcagcg cattcggccg cctgctcgcc      1020
     gatcagccgc tgatgcgcaa cgtgctcgcc gatctcgcgc tcgaatcgga agcggcgacc      1080
     gtgcttttca tgcggctcgc gcacgcgttc gaggaagacg cggccgcgcg ctcgccgcag      1140
     gcgcgcggct ggcgccgcat cgtcacgccg gccgcgaagt tctgggtctg caagcgcacg      1200
     ctcgaattca cgggcgaggc aatggaagta tggggcggca acggctacgt cgaaaccggg      1260
     ccgatggcgc gcttctatcg cgaagcgccc gtcaattcga tctgggaagg ctcgggcaac      1320
     gtgatgtgca tcgacgtgct gcgcgcgatc gagcgcgagc ccgacgcggc cgccgcgctc      1380
     ttcgacgaat ggcgcgacgc ggcgcggcac agcgcgccgc tcgccggcgc gctcgcggaa      1440
     ctgacgcgcc tgctgtcgct cgaacccgag ccgcgcgaag cctgcgcgcg ccggatcgca      1500
     caacgcatcg cactcgtcgc gcaggcctcg ctgctgctgc gcgacggccc ctacgccgtc      1560
     gcgcaggcgt tcgtcgccac gcgcttcggc cacgacagca gcgaaaccgg acgcgtcttc      1620
     ggcacgctgc cggccaccat cgatcacgcc gcgctcgtcg agcgggcgtt cccggcctga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page