(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE411

CP000124.PE411       Location/Qualifiers
FT   CDS_pept        434115..435617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51123"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX69"
FT                   /protein_id="ABA51123.1"
FT                   /translation="MTGIDTAAAAILASRIDSLLDAIQPAAGGAAAPQVGTSGAPPASA
FT                   APRPAASGPPPASAQTALSEVGLTLDAISRYGGAATPAVVGAAPLLPAAPTAVAAQAAS
FT                   LDPLLATPDARAGNPAAATAPGAQAAQAAPQAALPASPAAALSLALVQAVAQSGLFYES
FT                   HLAQWLAGQRTTAELAREPQARLASGAEPDAQAGAQPGQMGDALDDALADLLAVRLPLP
FT                   QGGRDAPARGAARPPGQPAGGADEGAAASGRAPTNAAAPARSVDAYAALADADGKPGAP
FT                   SAQTALARAGMPPTGADTPASIAASLHAATLPIVRQQLDLLATDQFRWIGEAWPGARLD
FT                   WTIEPDEQHGRERPAPDADFPDARGWRTRLTLALPSLGTIDAELVLNGEQLAARLRASE
FT                   AGAARLAPHGEALRARLQALGLQVSGLSIRAIDGVPDSFDAAAARAAASAYARAAAGGE
FT                   AVAKDGFGGAAGATGGAGGAGVEHRASSSSPVETDDDWEFAQ"
     atgaccggta tcgacaccgc tgccgccgcc atcctggcga gccgcatcga cagccttctc        60
     gacgcgatcc agcccgccgc gggcggcgcg gcggcgccgc aggtgggcac ctccggcgcg       120
     ccgcccgcct ccgcggcgcc tcggcctgcc gcgagcgggc cgccgcccgc ctctgcgcag       180
     accgcgctct ccgaggtcgg actcacgctt gacgcgattt cccgctacgg cggcgcggcg       240
     acgccggccg tcgtcggcgc cgcgccgttg ttgcctgcgg cgcccaccgc cgttgccgcg       300
     caggcggcgt cgctcgatcc gctgctcgcg acgcccgacg ctcgcgccgg caatccggcg       360
     gccgcgacgg cgccgggcgc gcaagccgcg caggcggccc cgcaagcggc gttgcccgcg       420
     tcgcccgccg ccgcgctgag cctcgcgctc gtgcaggccg tcgcgcagag cggcctcttc       480
     tacgaatccc atctcgccca atggctcgcc ggccagcgca cgacggccga gctcgcgcgc       540
     gagccgcagg cgcggctcgc aagcggcgcc gagccggacg ctcaggccgg cgcgcaacct       600
     ggccagatgg gcgacgcgct cgacgacgcg ctcgccgatc tgctcgccgt gcggttgccg       660
     ctgccgcagg gcgggcgcga tgcgcccgcg cggggcgccg cgcgcccgcc ggggcagccg       720
     gctggcggcg cggacgaagg cgcggcggca tccggccgcg cgccgacgaa cgcggcggcg       780
     cccgcgcgct ccgtcgatgc ctatgcggcg cttgccgacg ccgacggcaa gcccggcgcg       840
     ccgtcagcgc aaacggcgct cgcgcgcgcc ggcatgccgc cgacgggcgc cgacacgccg       900
     gcgtcgatcg cggcttcgct gcatgcggcg acgctgccga tcgtgcgcca gcagctcgat       960
     ctgctcgcga ccgaccagtt tcgctggatc ggcgaagcgt ggccgggcgc gcggctcgac      1020
     tggacgatcg agccggacga gcagcacggc cgcgagcggc ccgcgcccga cgcggatttc      1080
     ccggatgcgc gcggctggcg cacgcggctg acgctcgcgc tgccgtcgct cggcacgatc      1140
     gacgcggaac tcgtgctgaa cggcgagcag ctcgccgcgc ggctgcgcgc gagcgaagcg      1200
     ggcgcggcgc ggctcgcgcc gcacggcgag gcgctgcgcg cgcggctgca ggcgctcggg      1260
     ctgcaggtga gcggcctgtc gatccgcgcg atcgacggcg tgccggacag cttcgacgcg      1320
     gcggccgcgc gggcggcggc atccgcgtat gcgcgtgcgg cggcgggcgg cgaagcagtg      1380
     gcgaaggacg ggttcggagg cgcagccggc gcgacgggtg gggcgggcgg agcgggcgtt      1440
     gagcatcgcg catcgtcgtc gtcgccggtc gagaccgacg acgactggga gttcgcgcaa      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page