(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE415

CP000124.PE415       Location/Qualifiers
FT   CDS_pept        complement(438191..439594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0424"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49613"
FT                   /db_xref="GOA:Q3JX65"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX65"
FT                   /protein_id="ABA49613.1"
FT                   /translation="MSLFRKKNVDRMIAGAQAAGLKKALGAVDLTFLGIGAIIGTGIFV
FT                   LTGTGAVQAGPALMLSFVIAAIACGLAALSYAEFASTIPVAGSIYTYSYATLGELVAWI
FT                   IGWDLMLEYGLAASAVSVGWSGYLQSLLQGFGVSLPTALTAAPGALPGVVTYFNLPAFV
FT                   VMLVITTLLSIGIRESTRVNNIMVFIKVAVVLLVIAVGVFHVTPANWKPFMPHGWNGVF
FT                   GAAAVMFFAFIGFDAVSSAAEEVKNPKRDLPVGIIASLGVCAFLYVAVAAIATGIVPWA
FT                   QYANVSHPISYALQVAGEKWVAGFIDLGAVIGMLTVILVMSYGQTRIIFAMSRDGLLPA
FT                   ALSRVHPRFATPFLTTWLVGLFFGLIAALIPLNVLAELINIGTLAAFSMVSIAVLVLRR
FT                   THPDLPRAFRCPGVPLVPILAVAACLFLMLNLQPVTWIAFLTWLVIGLFVYFAYSRSRS
FT                   KLAHGAQQH"
     atgtctctct tccgcaagaa aaacgtcgac cgcatgatcg ccggcgcgca agcggccggc        60
     ctcaagaagg cgctcggcgc ggtcgacctc acctttctcg gcatcggcgc gatcatcggc       120
     accggcatct tcgtgctgac cggcacgggc gccgtgcagg ccgggccggc gctgatgctg       180
     tcgttcgtga tcgcggcgat cgcgtgcggc ctcgccgcgc tgtcgtacgc cgaattcgcg       240
     tcgacgatcc ccgtcgccgg ctcgatctac acgtattcgt acgcgactct cggcgagctc       300
     gtcgcatgga tcatcggctg ggacctgatg ctcgagtacg ggctcgccgc gtccgcggtg       360
     tcggtcggct ggtccggcta cctgcaatcg ctgctgcagg gcttcggcgt gtcgctgccg       420
     acggcgctca ccgccgcgcc gggcgcgctg ccgggcgtcg tcacgtattt caacctgccc       480
     gcgttcgtcg tgatgctcgt catcacgaca ctgctgtcga tcggcatccg cgaatcgacg       540
     cgcgtgaaca acatcatggt gttcatcaag gtcgccgtcg tgctgctcgt gatcgcggtc       600
     ggcgtcttcc acgtgacgcc cgcgaactgg aagccgttca tgccgcacgg ctggaacggc       660
     gtgttcggcg cggcggccgt gatgttcttc gcgttcatcg gcttcgacgc ggtgtcgtcg       720
     gccgccgagg aggtgaagaa cccgaagcgc gatctgccgg tgggcatcat cgcctcgctc       780
     ggcgtgtgcg cgttcctgta tgtcgcggtc gcggcgatcg cgacgggcat cgtgccgtgg       840
     gcccagtacg cgaacgtctc gcatccgatc tcgtacgcgc tgcaggtggc gggcgagaag       900
     tgggtggcgg gcttcatcga tctcggcgcc gtcatcggca tgttgaccgt gatcctcgtg       960
     atgagctacg gccagacccg gatcatcttc gcgatgtcgc gcgacggcct gctgcccgcc      1020
     gcgctctcgc gcgtgcaccc gcgcttcgcg acgccgttcc tgacgacctg gctcgtcggc      1080
     ctgttcttcg gcctgatcgc cgcgctgatt ccgctgaacg tgctcgccga gctgatcaac      1140
     atcggcacgc tcgccgcgtt ctcgatggtg tcgatcgcgg tgctcgtgct gcgccgcacg      1200
     cacccggatc tgccgcgcgc gttccgctgc ccgggcgtgc cgctcgtgcc gatcctcgcg      1260
     gtggccgcgt gcctgttcct gatgctgaac ctgcagccgg tcacgtggat cgcgttcctg      1320
     acgtggctcg tgatcggcct gttcgtgtac ttcgcgtact cgcgcagccg ctcgaagctc      1380
     gcgcacggcg cgcagcagca ctga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page