(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE422

CP000124.PE422       Location/Qualifiers
FT   CDS_pept        complement(444278..444688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48822"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX58"
FT                   /protein_id="ABA48822.1"
FT                   /translation="MVRDGQTIDAFEQKTTVGQARSDTHSLPIAPAAGCAATSAAASAA
FT                   DAPGSGLSRTITVAPLYVEDGAVALAIDAQETLADERATPPAGAPCTFALPRRIVASHP
FT                   GLNARAAQWTDWTLAERNPQLVYRVRARVVED"
     gtggtacgcg acggccagac gatcgatgcg ttcgagcaga agaccaccgt cggccaggcc        60
     cgctcggaca cgcacagctt gcccatcgcg ccggcggcgg gctgcgccgc gacatccgcg       120
     gccgcgtcgg cggccgatgc tcccggctcc ggcctgtcgc gcacgatcac cgtcgcgccg       180
     ctgtacgtcg aggacggcgc ggtcgcgctc gcgatcgacg cgcaggaaac gctcgccgac       240
     gaacgcgcga cgccgcccgc cggcgcgcca tgcacgtttg cgctgccgcg gcggatcgtc       300
     gcaagccatc cgggcctgaa cgcgcgcgcc gcgcaatgga ccgactggac gctcgccgag       360
     cgcaacccgc aactcgtcta ccgcgtgcgc gcacgcgtcg tcgaggactg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page