(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE427

CP000124.PE427       Location/Qualifiers
FT   CDS_pept        448057..449349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0436"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47640"
FT                   /db_xref="GOA:Q3JX53"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX53"
FT                   /protein_id="ABA47640.1"
FT                   /translation="MASIAASTKTAGQVLNRRAVVAAVIGNALEWYDFTVFSFMTVVIA
FT                   QLFFPTSSEYSSLLLTTATFGVAFFMRPIGGIVLGLYADRAGRKAALSLVILLMTFGIF
FT                   LIAVAPPYAAIGIGGPLLIVLGRLLQGFSAGGEFGSATALLIEAAPLSRRGYYGSWQMA
FT                   SQAAALLFGSLVGAAVTRGLSTEALHAWGWRVPFLIGLVIGPVGFYVRRHLVDSEAFLQ
FT                   ARERGEHVTLGEVFARHGRAVVCGLGAVIALTVTVYVLISYLPTFAVKQLKLPYAQSFY
FT                   AVIIGNLLLTALSPVAGAWSDRIGRKGLSLWALGLTLVMIYPLFAWLDASPSIARLIAV
FT                   QAMLSVTLAGYYGPFGAMIAELFPANVRSTGLSLAYNVAVMVFGGFGQFIVTWLIKTTG
FT                   TPLAPTYYVMAGLALSLVALAFVPAERDALD"
     atggcatcca ttgcggcttc gacgaaaacg gcggggcagg tgttgaaccg gcgcgcggtg        60
     gtggcggccg tgatcggcaa cgcgctcgaa tggtacgact tcaccgtctt cagcttcatg       120
     acggtcgtga tcgcccagtt gttctttccg accagcagcg aatattcgtc gctgctcctc       180
     accaccgcga cgttcggcgt cgcgttcttc atgcggccga tcggcggcat cgtgctcggc       240
     ctctacgcgg atcgcgcggg acgcaaggcg gcgctgtcgc tcgtgatcct gctgatgacg       300
     ttcggcatct tcctgatcgc ggtcgcgccg ccctatgcgg cgatcggcat cggcgggccg       360
     cttctcatcg tgctcggccg cctgctgcag ggcttctccg caggcggcga attcggcagc       420
     gcgaccgcgc tgctgatcga ggcggcgccg ctgtcgcggc gcggctacta cggcagctgg       480
     cagatggcga gccaggcggc ggcgctgctg ttcggctcgc tcgtcggggc ggccgtcacg       540
     cgcggcctgt cgaccgaggc gctgcacgcg tggggctggc gcgtgccgtt cctgatcggg       600
     ctcgtgatcg ggcccgtcgg tttctacgtg cgccgccatc tcgtcgattc ggaagcgttc       660
     ctgcaggcgc gcgagcgcgg cgagcacgtg acactcggcg aagtgttcgc gcggcacggg       720
     cgtgcggtgg tgtgcgggct cggcgcggtg atcgcgctca ccgtcaccgt ctacgtgctg       780
     atcagctatc tgccgacgtt cgccgtcaag caactgaagc tgccttacgc gcaatcgttc       840
     tatgcggtga tcatcggcaa cctgttgctg accgcgctgt cgcccgtcgc gggcgcgtgg       900
     tccgaccgca tcgggcgcaa ggggttgtcg ctgtgggcgc tcgggctcac gctcgtgatg       960
     atctatccgc tcttcgcctg gctcgacgcg tcgccgagca tcgcgcggct gatcgcggtg      1020
     caggcgatgc tctcggtgac gctcgccggc tactatgggc cgttcggcgc gatgatcgcc      1080
     gagctttttc cggcgaacgt gcgctcgacg gggctgtcgc tcgcgtataa cgtcgcggtg      1140
     atggtgttcg gcggcttcgg ccagttcatc gtcacgtggc tcatcaagac gacgggcacg      1200
     ccgcttgcgc cgacttatta cgtgatggcc gggctcgcgc tgtcgcttgt cgcgctcgcg      1260
     ttcgtgccgg cagagcgcga tgcgctcgat tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page