(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE43

CP000124.PE43        Location/Qualifiers
FT   CDS_pept        complement(51427..52293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0049"
FT                   /product="Pyridoxamine 5'-phosphate oxidase family"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48610"
FT                   /db_xref="GOA:Q3JY87"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY87"
FT                   /protein_id="ABA48610.1"
FT                   /translation="MRRQAHAWGRPIRVGPGRHGLAGHALPPGAPSHAACPGAAQRAAH
FT                   SRGDAADVSLPQARISHVNISAALPLHLLHRNVLGTLATHSRAPEGYPYPTVVPYAVDA
FT                   RHRPIVLVSGLAEHTRNLAADPRAGFLVVDGLGDAAGASDSVLEAERATLVGRFEPAGA
FT                   DPHVVARYLRYHPDGERYLALGDFTFWALACERLRYIGGFGRMGWLDATELDALAPVGY
FT                   DDERALWDEYGASRERRAGLELLGVDRYGADWRLNGLKRRTPFDAPKMDVESLLAALRE
FT                   AAAVSLM"
     atgcgccgcc aggcgcatgc ttgggggcga ccgatccggg tcggtccggg ccggcacggc        60
     ttggccggcc atgcgctccc gccgggtgca ccgtcgcatg ccgcatgccc gggggcggcg       120
     caacgcgccg cgcacagccg cggcgacgcg gccgacgtct cgcttccgca agcaaggatt       180
     tcgcacgtga acatttctgc agccttaccg cttcatttgc tccatcgcaa cgtgctcggc       240
     acgctcgcga cgcactcgcg cgcgcccgag ggctatccgt atccaaccgt ggtgccgtat       300
     gcggtcgacg cgcggcaccg gccgatcgtg ctcgtgagcg ggctcgccga gcacacgcgc       360
     aatctcgcgg ccgatccgcg cgccgggttt ctcgtcgtcg acggcctggg ggacgcggcg       420
     ggcgcgtcgg acagcgtgct cgaggcggag cgcgccacgc tcgtcggccg cttcgagccg       480
     gccggcgccg atccgcacgt ggtcgcgcgt tatttgcgct atcacccgga cggcgagcgc       540
     tatctcgcgc tcggcgactt tacgttctgg gcgctcgcgt gcgagcggct gcgctatatc       600
     ggcggattcg ggcgaatggg atggctcgac gcgaccgagt tggacgcgct cgcgcccgtc       660
     ggctacgacg acgaacgcgc gctatgggac gaatacggcg cgtcgcggga gcggcgcgcg       720
     gggctcgagc tgctcggcgt tgaccgttat ggcgcggact ggcgtttgaa cgggctcaag       780
     cgccgcacgc cgttcgacgc gccgaaaatg gatgtcgaat cgctgctcgc ggcgctgcgc       840
     gaggccgccg ccgtttcgct catgtaa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page