(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE432

CP000124.PE432       Location/Qualifiers
FT   CDS_pept        complement(454270..455775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX48"
FT                   /protein_id="ABA48973.1"
FT                   /translation="MPGAGIGACGSGAAATLPAASAPAGGHASPPVAHAPASTALASER
FT                   ARQRRGARAACVAARRTPLRERRAASRAATASGIRLPHLLGAMAGDKPAVDVAQLRLLD
FT                   AAPLDRVRAALMERAAGRRVERRRHLALQLDLDLAIRLEDRGRRRHQRARVRVPRPRVD
FT                   RLLVAELRDAAEVHHHHIVGDVLDDREVVRDEHVARFELLLQIHEEIQDLRLDRHVERG
FT                   HRLVGDDDLRIEDHRARDRDALALPAREHVRIALRVLGAQAHRAHDLRDALRALGGREP
FT                   RVDRERLGKRLLDRLARIERGERILEHHLHAAAQRGDRLPVRARDVAAVDRQVPRARRL
FT                   DHRELPRERRLAAAGFADDGERLAAREGERHAVQRLHGAVAEHPAPHRVVLRELVGHQH
FT                   HVVARGGFARFVDCVHRAPPCVCGASRLRGLMQRARMPVPGASSASVGRAFMQSSTTYL
FT                   QRGANRHPLGRSSRPGTIPGSAASRFAPALCSGIAASNASVYG"
     atgccgggcg cgggaatcgg cgcctgcggc agcggcgcgg ccgcgacgct gcccgccgcc        60
     agcgcgccgg cgggcggcca tgcgagcccg cccgtcgcgc acgcgccggc gagcacggcg       120
     ctcgcgagcg agcgcgcgcg ccagcgccgg ggcgcgcgtg cggcgtgcgt cgccgcgcgc       180
     cgcacgccgt tacgcgagcg gcgcgcggct tcgcgcgccg ccactgcctc aggcattcgc       240
     ctcccccacc tcctcggcgc gatggcaggc gacaagccgg ccgtcgacgt cgcgcagctt       300
     cggctcctcg acgcggcacc gctcgaccgc gtacgggcag cgctgatgga acgcgcagcc       360
     ggacggcggg ttgagcggcg acggcatctc gccctgcagc ttgatctgga tcttgcgatc       420
     cgcctcgaag atcgcgggcg tcgccgacat cagcgcgcgc gtgtacgggt gccgcggccg       480
     cgcgtagatc gtcttcttgt cgccgagctc cgcgacgctg ccgaagtaca tcaccatcac       540
     atcgtcggcg atgtgctcga cgaccgagag gttgtgcgag atgaacacgt agctcgtttt       600
     gaactgctcc tgcagatcca tgaagagatt caggatctgc gcctggatcg acacgtcgag       660
     cgcggacacc ggctcgtcgg cgacgacgat ctgcggatcg aggatcatcg cgcgcgcgat       720
     cgcgacgcgc tggcgttgcc cgcccgagaa catgtgcgga tagcgcttcg cgtgctcggg       780
     gcgcaggccc accgtgcgca tgatctgcgc gatgcgctgc gcgcgctcgg cggccgtgag       840
     ccgcgtgttg atcgcgagcg gctcggcaag cgtctgctcg accgtcttgc gcggattgag       900
     cgaggcgaac ggattctgga acaccatctg cacgcggcgg cgcagcgcgg cgaccgtctc       960
     ccggtccgcg cccgcgacgt cgcggccgtc gatcgacagg tgccccgcgc tcggcggctc      1020
     gatcatcgtg agctgccgcg cgagcgtcga cttgccgcag ccggattcgc cgacgacggc      1080
     gagcgtcttg ccgcgcgcga gggagaacga cacgccgttc agcgccttca cggtgccgtg      1140
     gccgaacatc ccgcgccgca ccgcgtagtg cttcgcgagc tggtcggcca ccagcaccac      1200
     gtcgttgcgc gcggcggatt cgcgcgtttc gtggactgcg ttcatcgcgc gcctccttgc      1260
     gtgtgcggcg cttccaggtt gaggggcttg atgcagcgcg cgcgcatgcc ggtgcccggc      1320
     gcgagctcgg cgagcgtagg ccgcgccttc atgcagtcgt cgacgacgta cttgcagcgc      1380
     ggcgcgaaca ggcacccgct cggccggtcg tcgcggcccg gcaccatccc cggcagcgcg      1440
     gcgagccgct tcgcgcccgc attgtgctcc ggaatcgccg cgagcaacgc ttcggtgtac      1500
     ggatga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page