(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE435

CP000124.PE435       Location/Qualifiers
FT   CDS_pept        456888..458564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50007"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX45"
FT                   /protein_id="ABA50007.1"
FT                   /translation="MPARFRRAGSGCLHARRGQHHNKPPCRHVRPFDGRSAVRPGQADA
FT                   GGGGRIFHLERRVRARRCAAVGRRAARIGRPIEAKAPEGAFFMAARARSPKHQNIQQDD
FT                   VRREQRERGGKLHLDHAVLVGQFEQRGGHHVEVRGHRRHQRAAVAGEHPDRDHHGRIAM
FT                   EHVDEDRHADAARHHGERGEAVAHHHREERHADAVHGDRDEPVVEVHVRGGHVGDRLAD
FT                   ARVREHQPEHAEHLRQHGRPRQRVDQPPRLLQRLADRIARDPAREPEGDHAADAETDQR
FT                   DVLRIDERRAADVQMAGREGDRDRHERDRERRHEQPVADARGARAARIVGRQLRSRRRH
FT                   AAETRDQRHHDHERADELDGQLVADEEDERVQQPEAARGEAARVRAVRDDRRAHREQHE
FT                   ADEPEQVTDRERHARPPLSAAAFAPFEAACGAALARSSRSSRRSSSHSRAPWITNADTA
FT                   VGMPHSATRIGSTAMPASFRNVTISTIAPNATKISSPKKRPTLSVAAAYARSRWRIASG
FT                   SGPKRFSVAPSAIGAISGRTICGWPPRPVRPTAAVSSRTSR"
     ttgccggcac gctttcggcg tgccggcagc ggttgtctgc atgcacgacg gggccaacat        60
     cacaacaagc caccatgcag gcacgtacgc ccattcgatg ggcgttccgc cgtccggccg       120
     gggcaagcag acgcgggcgg cggcggacgc atttttcatc tcgagcgccg ggtgcgggcg       180
     cgacggtgcg cagccgtcgg ccggcgcgcc gcgcggatcg gccggccgat cgaagccaaa       240
     gcgcccgagg gcgctttttt catggccgcg cgcgcgcgct caccgaaaca tcagaacatt       300
     cagcaggacg atgttcgtcg cgagcagcgc gagcgcggtg ggaaactgca ccttgatcac       360
     gccgttcttg tcgggcaatt cgagcagcgc ggcgggcacc atgttgaagt tcgcggccat       420
     cggcgtcatc agcgtgccgc agtagccgga gaacatcccg atcgcgacca tcacggccgg       480
     atcgccatgg aacacgtcga cgaggatcgg cacgccgacg ccgcccgtca tcacggggaa       540
     cgcggcgaag ccgttgccca tcaccatcgt gaagagcgcc atgccgatgc agtacacggc       600
     gaccgcgatg agccggtagt cgaggttcac gtacgcggtg gtcacgtggg cgaccgcctt       660
     gccgacgccc gcgtccgaga acaccagccc gagcatgccg agcatctgcg gcagcacggc       720
     cgcccacgac agcgcgtcga tcagccgccg cgcctcctgc agcgattggc cgaccgaatc       780
     gcgcgtgatc cagcacgcga acccgagggc gatcacgcag ccgatgccga aaccgatcag       840
     cgtgacgttc ttcggatcga cgagcggcgc gccgccgacg tgcagatggc tggccgcgag       900
     ggtgatcgcg accgtcacga acgggatcgt gagcgccggc acgaacagcc ggttgccgat       960
     gcgcgcggcg ctcgcgcggc gcgcatcgtc ggacggcagc ttcggtctcg ccgccgtcac      1020
     gccgccgaaa cccgcgatca gcgccatcac gatcacgagc gcgccgacga gctcgacggg      1080
     cagcttgtcg ccgacgagga agacgagcgc gtacagcagc cagaagccgc ccgcggtgaa      1140
     gcggcgcggg tgcgcgcggt ccgtgacgat cgtcgcgccc accgcgagca gcacgaggcc      1200
     gacgagccag aacaggtaac cgatcgtgag cgtcatgcgc ggcctccgtt gtcggcggcg      1260
     gcgttcgcgc cattcgaggc ggcgtgcggc gcggcgctcg cgcgcagttc gcgctcgagc      1320
     cggcgatcga gcagccacag ccgcgcgccg tggatcacga acgcggacac ggcggtcggg      1380
     atgccccaca gcgcgacgcg catcggctcg acggcgatgc cggcctcctt caggaacgtc      1440
     accatcagca cgatcgcgcc gaacgcgacg aagatatcct cgccgaagaa gaggccgacg      1500
     ttgtcggtcg cggccgcgta cgcgcgcagc cggtggcgga tcgcgtcggg cagcggaccg      1560
     aaacggttct cggtcgcgcc ttcggccatc ggcgcgatta gcggccgcac catctgcgga      1620
     tggccgccca ggcccgtcag gccgacggcc gcggtcagct cgcgcacgag cagatag         1677
//

If you have problems or comments...

PBIL Back to PBIL home page