(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE440

CP000124.PE440       Location/Qualifiers
FT   CDS_pept        complement(461381..462151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0449"
FT                   /product="conserved hypothetical protein TIGR00370,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02682;
FT                   match to protein family HMM TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50745"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX40"
FT                   /protein_id="ABA50745.1"
FT                   /translation="MYAKVVRATPRQIFLARSYRHFIDNVFFTRLNAVCFPSMTTPRIY
FT                   PLGDTALVCEAPPPATLECQRRVWAVASAAAGWPHVVDVVPGMNNLTIVFDPLETTADT
FT                   LAPLMKAAWRDADGVAESGREIEIPVEYGGAFGPDLDAVARHTGLARDEVVRRHAAGTY
FT                   VVFFLGFQPGFTYMGGLDGSLHTPRRAAPRLEVPAGSVGIGGEQTGIYPAAAPGGWQLI
FT                   GRTPLALFDPARTPPTLLQPGDRVRFIVAGVHAG"
     gtgtacgcca aagtcgtccg cgcgacgccg cggcagattt ttttggcgag aagttatcga        60
     cattttattg ataatgtatt cttcactcgg ctcaacgccg tttgctttcc atcgatgacc       120
     actccacgca tctatccgct tggcgacacc gccctcgtgt gcgaggcgcc cccgcccgcg       180
     acgctcgaat gtcagcgccg cgtgtgggcg gtcgcgagcg cggcggcggg ctggccgcac       240
     gtcgtcgacg tggtgcccgg catgaacaat ctgacgatcg tgttcgatcc gctcgaaacg       300
     accgccgaca cgctcgcgcc gctgatgaag gccgcgtggc gcgacgccga cggcgtcgcc       360
     gaaagcggcc gcgagatcga gatccccgtc gagtacggcg gcgcgttcgg ccccgatctc       420
     gacgcggtcg cgcggcacac ggggctcgcg cgcgacgaag tcgtgcgccg ccatgcggcg       480
     ggcacctacg tcgtgttttt cctcggcttt cagccgggct tcacctacat gggcggcctg       540
     gacggctcgc tgcacacgcc gcggcgcgcc gcgccccggc tcgaagtgcc cgccggctcg       600
     gtcggcatcg gcggcgagca gaccggcatc tatccggccg ccgcgccggg cggctggcag       660
     ttgatcggcc gcacgccgct cgcgctcttc gatcccgcgc gcacgccgcc cacgctgctg       720
     cagccgggcg accgcgtacg ctttatcgtc gcgggagtgc atgccggatg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page