(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE441

CP000124.PE441       Location/Qualifiers
FT   CDS_pept        462187..462699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49420"
FT                   /db_xref="GOA:Q3JX39"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX39"
FT                   /protein_id="ABA49420.1"
FT                   /translation="MQRHPTKIVSSEHLVSETSAELSELEYALIMAGNAFNRWMVRCMA
FT                   AAGAKDMTAVEVSLLHHVSHRDRKKKLADICFVLNIEDTHVATYALRKLVARGYVKSEK
FT                   TGKEVFFDATDAGRALCLRYRDVRERCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTA
FT                   ARAAASL"
     atgcagcgcc atccgaccaa gatcgtatcg tccgaacatc tcgtttccga gacaagcgcg        60
     gagctctccg agctcgaata tgcgctcatc atggcgggaa atgcgttcaa tcgctggatg       120
     gtccggtgca tggcggcggc cggagcgaag gacatgacgg cggtcgaggt gtcgctgctg       180
     caccacgtga gccaccggga ccgcaagaag aagctggccg acatttgctt cgtgctcaac       240
     atcgaggaca cgcacgtcgc gacgtatgca ctcaggaagc tggtagctag agggtacgta       300
     aaaagcgaaa agacaggcaa ggaagtgttc tttgacgcaa ccgacgcggg ccgcgcgctg       360
     tgcctcaggt accgcgacgt gcgcgagcgc tgcctgatcg agaccctgaa ggacagcggg       420
     ctcacgaacg agcagatcgg cgacgccgcg caactgctgc gccacgcgtc ggggctgtac       480
     gacaccgcgg cgcgcgcggc cgcgtcgctg tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page