(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE442

CP000124.PE442       Location/Qualifiers
FT   CDS_pept        462902..463546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX38"
FT                   /protein_id="ABA49138.1"
FT                   /translation="MTARGDAPAAAALCGSIVRPIEPRLGDDPVERQIVRFARQLAHAA
FT                   RVVCDAHRHGRRRARPCGERAVVIAAAVAEPEAAVIEADARNQQQLRHEPRARRGLGNP
FT                   VAALAHRRIGRPRMEFERRAGLADHGQRGLPARVAGEPRRDRIARVEFARQRPVEADRA
FT                   RRALRENREHAPRERVVRARRALRVEAAPSKRFAQRALRIRRRGACYAFAH"
     atgaccgcgc gcggcgacgc accggccgcc gccgcgctgt gcgggtcaat cgtccgaccg        60
     atagagccgc gtctcggtga cgatccagtc gagcggcaga tcgtgcgctt cgcgcggcag       120
     ctcgcgcacg ccgcacgcgt cgtatgcgac gcccaccgtc acgggcggcg tcgcgcccgg       180
     ccatgcggcg agcgtgcggt cgtaatagcc gccgccgtag ccgagccgga agcagccgtg       240
     atcgaagccg acgcacggaa tcagcagcag ctccggcacg agccgcgcgc ccgccgcggg       300
     ctcggcaatc cggtggcggc cctcgcgcat cggcgcatcg ggcgtccacg catggaattc       360
     gagcggcgtg cggggcttgc cgatcacggg cagcgcggcc tgccggctcg cgtcgccggc       420
     gagccacgac gcgatcgcat cgcgcgcgtc gaattcgccc ggcagcggcc agtagaagcc       480
     gaccgtgcgc ggcgcgcatt gcgcgagaat cgcgagcacg cgccgcgcga gcgcgtcgtg       540
     cgcgcgcggc gcgcgctgcg cgtcgaggcg gcgccgagca agcgtttcgc gcagcgtgcg       600
     cttcggattc ggcgccgggg cgcgtgctat gctttcgctc actag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page