(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE443

CP000124.PE443       Location/Qualifiers
FT   CDS_pept        complement(462947..463543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0452"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01812"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48490"
FT                   /db_xref="GOA:Q3JX37"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX37"
FT                   /protein_id="ABA48490.1"
FT                   /translation="MSESIARAPAPNPKRTLRETLARRRLDAQRAPRAHDALARRVLAI
FT                   LAQCAPRTVGFYWPLPGEFDARDAIASWLAGDASRQAALPVIGKPRTPLEFHAWTPDAP
FT                   MREGRHRIAEPAAGARLVPELLLIPCVGFDHGCFRLGYGGGYYDRTLAAWPGATPPVTV
FT                   GVAYDACGVRELPREAHDLPLDWIVTETRLYRSDD"
     gtgagcgaaa gcatagcacg cgccccggcg ccgaatccga agcgcacgct gcgcgaaacg        60
     cttgctcggc gccgcctcga cgcgcagcgc gcgccgcgcg cgcacgacgc gctcgcgcgg       120
     cgcgtgctcg cgattctcgc gcaatgcgcg ccgcgcacgg tcggcttcta ctggccgctg       180
     ccgggcgaat tcgacgcgcg cgatgcgatc gcgtcgtggc tcgccggcga cgcgagccgg       240
     caggccgcgc tgcccgtgat cggcaagccc cgcacgccgc tcgaattcca tgcgtggacg       300
     cccgatgcgc cgatgcgcga gggccgccac cggattgccg agcccgcggc gggcgcgcgg       360
     ctcgtgccgg agctgctgct gattccgtgc gtcggcttcg atcacggctg cttccggctc       420
     ggctacggcg gcggctatta cgaccgcacg ctcgccgcat ggccgggcgc gacgccgccc       480
     gtgacggtgg gcgtcgcata cgacgcgtgc ggcgtgcgcg agctgccgcg cgaagcgcac       540
     gatctgccgc tcgactggat cgtcaccgag acgcggctct atcggtcgga cgattga          597
//

If you have problems or comments...

PBIL Back to PBIL home page