(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE45

CP000124.PE45        Location/Qualifiers
FT   CDS_pept        complement(53819..54961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0051"
FT                   /product="putative extracellular ligand binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50497"
FT                   /db_xref="GOA:Q3JY85"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY85"
FT                   /protein_id="ABA50497.1"
FT                   /translation="MNIKMQKLLPISAAAMLLAAAATNAAADQVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKVTLQLDAQDDAADPRTATQVAQKLVDDKVVAV
FT                   VGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYA
FT                   RSKGVKSVAVVDDSTAYGQGLANEFEKKAKALGLKVVSHDATNDKAVDFRAILTKIKGE
FT                   NPDAVMYGGMDATGGPFAKQAKQLGLRAKIFAGDGVCTEKLADLAGDATDNVVCSEAGA
FT                   SLEKMPGGAAFKAKYEKRFGQPIQIYAPFTYDAVYIIVDAMKRANSTDPAKIVAAMPKT
FT                   NYTGVIGTTTFDSKGDLQHGVISLYDYKGGKKTFLDEVKM"
     atgaatatca agatgcaaaa gctgctgccg atcagcgcgg cggctatgct gttggccgca        60
     gccgccacga acgctgccgc cgaccaggtc gtcaagatcg gccatgtcgc accgttgacg       120
     ggcgggatcg cccaccttgg taaggacaac gaaaatggtg cgcgcctcgc ggtcgaggag       180
     atcaacgcga agggactcac gatcggcggc cagaaggtga cgctccagct cgatgcacag       240
     gacgacgcgg ccgacccgcg caccgcgacg caggtcgcgc agaagctcgt cgacgacaag       300
     gtcgtcgcgg tcgtcggcca cctgaactcg ggtacctcga ttccggcctc gaagatctac       360
     agcgatgcgg gcatcgtgca gatctcgccg tcggcgacga acccggctta cacgcagcaa       420
     ggtttcaaga cgacctaccg cgtcgtcgcg accgacgcgc agcagggccc ggcgctcgcg       480
     aactacgcgc gctcgaaggg cgtgaagagc gtcgccgtcg tcgacgattc gacggcctac       540
     ggccagggcc tcgcgaacga attcgagaag aaggcgaagg cgctcggcct gaaggtggtg       600
     tcgcacgacg cgacgaacga caaggcggtc gacttccgcg cgatcctgac gaagatcaag       660
     ggtgaaaatc cggacgccgt gatgtacggc ggcatggacg cgacgggcgg cccgttcgcg       720
     aagcaggcga agcagctcgg cctgcgcgcg aagatcttcg cgggcgacgg cgtctgcacg       780
     gaaaagctcg cggacctcgc gggcgatgcg accgacaacg tcgtgtgctc ggaggcgggc       840
     gcgtcgctcg agaagatgcc gggcggcgcg gcattcaagg cgaagtacga gaagcgtttc       900
     ggccagccga tccagatcta cgcgccgttc acgtatgacg cggtgtacat catcgtcgac       960
     gcgatgaagc gcgcgaactc gacggatccg gcgaagatcg tcgcggcgat gccgaagacg      1020
     aactacaccg gcgtgatcgg cacgacgacc ttcgattcga agggcgacct gcagcacggc      1080
     gtgatctcgc tgtacgacta caagggcggc aagaagacgt tcctggatga agtgaagatg      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page