(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE450

CP000124.PE450       Location/Qualifiers
FT   CDS_pept        complement(469899..470393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0459"
FT                   /product="flagella synthesis protein FlgN, putative"
FT                   /note="identified by match to protein family HMM PF05130"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50586"
FT                   /db_xref="GOA:Q3JX30"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX30"
FT                   /protein_id="ABA50586.1"
FT                   /translation="MHHMAHGRSARRHVERNEMRDELLATVNDEHATVEAFASLLAYEE
FT                   KALTTAAPLDALPGIVERKTELLEKLAQLERRRDTLLASLGLPAGKKGMDLAAENDARL
FT                   ANGWQLLQHSAERARHANAINGMLIRIRMDYNERTLSVLRAAPQRNGFYGPDGRVAAVA
FT                   R"
     atgcaccaca tggcgcacgg acggtccgcg cgccgccatg tcgagcgaaa cgagatgaga        60
     gacgaactgc tggccacggt caacgacgag cacgcgacag tcgaggcgtt cgcgtccctg       120
     ctcgcatacg aggagaaggc actgaccacg gcggcgccgc tcgacgcgct gccgggcatc       180
     gtcgagcgga aaaccgagct gctcgagaag ctcgcgcagc tcgagcgccg ccgcgacacg       240
     ctgcttgcgt cgctcggcct gccggccggc aagaaaggca tggatctcgc cgcggaaaac       300
     gacgcgcgcc tcgcgaacgg ctggcagttg ctgcagcatt cggccgaacg tgcgcgccac       360
     gcgaacgcga tcaacgggat gctgatccgc atccgaatgg actacaacga acgcacgctg       420
     tccgtgctgc gcgccgcgcc gcagcgcaac ggcttctacg ggccggacgg gcgcgtcgcc       480
     gccgtcgcac gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page