(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE463

CP000124.PE463       Location/Qualifiers
FT   CDS_pept        480525..481283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0472"
FT                   /product="YcgR protein superfamily"
FT                   /note="identified by match to protein family HMM PF07317"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50725"
FT                   /db_xref="GOA:Q3JX17"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX17"
FT                   /protein_id="ABA50725.1"
FT                   /translation="MNTEQSTSPAASAAAHSGHDYGRRNPLEIGVQLRNLVNRGDFLTV
FT                   QYQGGQLVTRILDVDVGARTFVFDWGALADQNAGILAAPRCVFDASPDGVRVEFSTATP
FT                   RETRYENLPAFEADFPDVLYCMQRREYFRVDAPILDPYVCRGRLPDGETFLFEVHNLSL
FT                   GGLGLRTSDDRVASLEPGMTLPDVELNLNGHGMLSLDLQLVSHRASETPSGARRYQLGF
FT                   RFVSLPGSAENTLQRIITQLEMKRRQLARA"
     atgaataccg aacagtcgac gagtccggcc gcgagtgccg ccgcgcattc cggccacgat        60
     tacggccgcc gcaatccgct cgagatcggc gtgcagttgc gcaacctcgt caatcgcggc       120
     gatttcctga ccgtccagta ccagggcggc cagctcgtca cccgcattct cgatgtcgac       180
     gtcggcgcgc ggaccttcgt attcgactgg ggtgcgcttg ccgatcagaa cgccggcatt       240
     ctcgccgcgc cgcgctgcgt gttcgacgcg tcgccggacg gcgtgcgcgt cgagttctcg       300
     accgctaccc cgcgcgaaac ccgttacgag aacctgcccg cgttcgaagc cgatttcccc       360
     gacgtgctgt actgcatgca gcgccgcgaa tatttccggg tcgacgcgcc gatcctcgat       420
     ccgtacgtat gccgcggcag gctgcccgac ggcgagacct tcctgttcga agtgcacaac       480
     ctgtcgctcg gcggcctcgg gctgcgcacg agcgacgacc gcgtggcgtc gctcgagccc       540
     ggcatgacgc tgcccgacgt cgagctgaac ctgaacggcc acgggatgct gtcgctcgac       600
     ctgcaactcg tgtcgcaccg cgcgagcgag acgccgagcg gcgcgcgccg ctaccagctc       660
     ggctttcgct tcgtgtcgct gccgggcagc gccgagaaca cgctgcagcg catcatcacg       720
     cagctcgaga tgaagcgccg gcaactcgcg cgcgcctga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page