(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE472

CP000124.PE472       Location/Qualifiers
FT   CDS_pept        complement(489067..489405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50603"
FT                   /db_xref="GOA:Q3JX08"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX08"
FT                   /protein_id="ABA50603.1"
FT                   /translation="MTAAKFFLRYTLVPFVAIVLVVVWAFNRESDEIDARQYAALVAAY
FT                   PGFTPDLRDEVNRAMRDGKLAKSDYASIVRDSLNHGYVLDWSSTNVDLNAERGKLLGLV
FT                   KSDAHAPD"
     atgaccgccg ccaagttctt cctgcgctat accctcgtgc cgttcgtcgc gatcgtgctc        60
     gtcgtcgtgt gggcattcaa tcgcgaatcg gacgagatcg acgcgcggca gtacgcggcg       120
     ctcgtcgccg cctatcccgg cttcacgccg gacctgcgcg acgaagtgaa tcgcgcgatg       180
     cgcgacggca agctcgcgaa gtccgattac gcgtcgatcg tccgcgattc gctcaatcac       240
     ggctacgtgc tcgactggtc gtcgacgaac gtcgatctga atgccgagcg cggcaaattg       300
     ctcggcctcg tcaagagcga cgcgcacgcg ccggactga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page