(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE476

CP000124.PE476       Location/Qualifiers
FT   CDS_pept        complement(492441..493274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0485"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX04"
FT                   /protein_id="ABA51131.1"
FT                   /translation="MKKLVTLMIAGALVALPCTTNLNAAQAATRAPAVAGSPGSAIVFV
FT                   NGINNTFDDAIASLQVLKTQLNARDANNAYVYGNAYNATQGTFSDLWQVFKQKSVEGTS
FT                   PADFWRAIDGGTVPAGGMDAALQQKYIDILTKSETPELPDHLNQYRAYLQQNRKVVLVG
FT                   HSQGTLYANFEMNLLITGPERAQGRISSVNVGNAARYLLPGSSYLTSSSDTVIGSLGLV
FT                   QTVMPSNFSLGLHLFTDPLGHSFTKIYLNPSFSAARQILTQVSQQANSAAKAAVR"
     atgaaaaagt tagtgacgct gatgattgcc ggcgcgctcg ttgcgctgcc ctgcacgacg        60
     aacctgaacg ccgcgcaggc ggcgacgcgc gcgccggccg tggcgggctc gcccggctcc       120
     gcgatcgtgt tcgtcaacgg catcaacaac acgttcgacg atgcgatcgc cagcctgcaa       180
     gtgctgaaga cccagctgaa cgcgcgcgac gcgaacaacg catacgtgta cggcaacgcg       240
     tacaacgcga cgcaaggcac gttcagcgat ctgtggcagg tgttcaagca gaagtcggtc       300
     gaaggcacga gcccggcgga tttctggcgc gcgatcgacg gcggcacggt tcccgcgggc       360
     ggcatggacg cggcgctgca acagaaatac atcgatatcc tgacgaaaag cgagacgccc       420
     gagctgcccg atcatctgaa ccaataccgc gcgtatctgc agcagaaccg caaggtggtg       480
     ctcgtcggcc actcgcaggg cacgctgtac gcgaacttcg agatgaacct gctgatcacg       540
     gggccggagc gcgcgcaagg ccggatcagc tcggtgaacg tcggcaacgc ggcgcgctat       600
     ctgctgccgg gctcgagcta cctgacgtcg tcgtcggata cggtgatcgg cagcctcggg       660
     ctcgtccaga cggtgatgcc gtcgaacttc tcgctcggcc tgcacctgtt caccgatccg       720
     ctcggccact cgttcacgaa gatctacctg aacccgtcgt tctcggcggc caggcagatc       780
     ctcacgcaag tgtcgcagca ggcgaacagc gcggcgaagg cggccgtgcg ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page