(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE482

CP000124.PE482       Location/Qualifiers
FT   CDS_pept        complement(498582..498842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50287"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ8"
FT                   /protein_id="ABA50287.1"
FT                   /translation="MLFQFLAVRFVHGPLFARRRRAAAARAPSALAMRPTVRARLPFIP
FT                   RPAGCAIVAATAGAVALGALLSASGQQVGLNQAIRVSWWFS"
     atgctgtttc aatttctcgc cgtcagattc gtacacggcc cgcttttcgc acgccggcgg        60
     cgcgccgccg cagcccgcgc gccgtcggcg ctcgccatgc gccccaccgt gcgcgcgcgg       120
     ctcccgttca tcccgcgccc ggccggctgc gcaatcgtcg ccgcgacggc gggcgccgtc       180
     gcgctcggcg cgctgctgtc ggcgtcgggc cagcaggtcg gcctgaacca ggccatccgc       240
     gtgagctggt ggttctcgta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page