(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE486

CP000124.PE486       Location/Qualifiers
FT   CDS_pept        502282..502590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ4"
FT                   /protein_id="ABA48781.1"
FT                   /translation="MLPNVTNAARHERPCNHARSRSTLTVIAMGILNTVGEIAGAVAAV
FT                   EAAEKVDPDAGLLTKAAAAVAGFKGAEALENLVEKKKDDEAADGENTAAPDSDASQA"
     gtgctaccga atgtgacaaa cgcggcgcgg catgaacgtc catgcaatca tgctcgctca        60
     cgttcaaccc taacggtgat tgcgatggga atcctgaata cggtaggtga aattgcgggc       120
     gcggtggcgg ccgtcgaggc ggcagagaag gtcgatccgg atgccggcct gctgacgaag       180
     gcggccgccg cggtcgcggg cttcaagggg gcggaggcgc tcgagaatct cgtcgagaaa       240
     aagaaggacg acgaagcggc cgacggcgag aacacggccg cgccggacag cgacgcgtcg       300
     caggcgtga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page