(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE488

CP000124.PE488       Location/Qualifiers
FT   CDS_pept        504018..505496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48696"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ2"
FT                   /protein_id="ABA48696.1"
FT                   /translation="MTVRARRAARNSKTCYRPVIGVSIRRRYGIRLRSLCHRRGLGRRA
FT                   PEPRRGVLRRARRHRRGRAHRRHLRAARLHPEKAARLRVALQPRCRGRRGLWLDLRHRP
FT                   VFVADAHRGEGPRDRAPERYLRRSAEQVGRRDPYGARDARRRAYGRRRGPACHRPAHRR
FT                   RDRLAAGAAADSRHRARDHVARGARVARAAAADRDRRRRLHRGRVRGHLQRARRRCRPV
FT                   LSRRADPARLRRRRAARVAWRDDEAGCRHPYARDDRGDRARRRRRVDAQARRGRVRAVR
FT                   RGAVCDGARREWRRARARGGRGRARRERRDRSRRLFGDDGAVDPRDRRRHRAPATDARR
FT                   DARRHAARGEPVRRQADRRRSSLRSFRGVQPAGDRDGRAHRGASARRARRARHLQDVVP
FT                   RAAAHVVRPRRKDVHEARRRARQPARRRRAHGRARRGGDHPGHRDRDPGGRDEGAVRRD
FT                   GRHPSNRGRGVRHVAAEGAGRRMTPDWRGARRLV"
     atgacagtac gcgcgcgccg cgccgcaaga aattcgaaaa cttgctatcg tccggtcatc        60
     ggggtttcga tcagacgacg ctatggaatt cgactacgat ctctttgtca tcggcgcggg       120
     ctcgggcggc gtgcgcctga gccgcgtcgc ggcgtcctac ggcgcgcgcg tcggcatcgc       180
     cgaggaagag cgcatcggcg gcacctgcgt gctgcgcggc tgcatcccga aaaagctgct       240
     cgtctacgcg tcgcattaca gccacgatgt cgaggacgcc gcgggctatg gctggacctt       300
     cgacatcggc ctgttttcgt ggccgacgct catcgaggcg aaggaccgcg agatcgcgcg       360
     cctgagcggt atctacgtcg atctgctgaa caagtcgggc gtcgagatcc atacggggcg       420
     cgcgacgctc gtcggcgcgc atacggtcga cgtcgcgggc cggcgtgtca ccgcccggca       480
     catcgccgtc gcgacaggct cgcggccggt gctgccgccg attcccggca tcgagcacgc       540
     gatcacgtcg cgcgaggcgc tcgagttgcc cgagctgccg cagcggatcg cgatcgtcgg       600
     cggcggctac atcgcggtcg agttcgcggg catcttcaac gggctcggcg tcgatgtcga       660
     cctgttctat cgcggcgagc agatcctgcg cggcttcgac gacgacgtgc ggcacgcgtt       720
     gcatggcgag atgacgaagc agggtgtcgc catccatacg cgcgcgacga tcgaggcgat       780
     cgagcgcggc gccgacggcg ggttgacgct caggctcgcc gagggcgcgt acgggccgta       840
     cgacgcggtg ctgtatgcga cggggcgcgt cgcgaatggc gacgggctcg ggctcgaggc       900
     ggtcggggtc gcgcgcgacg cgaacggcgc gatcgaagtc gacgcctatt cggcgacgac       960
     ggtgccgtcg atccacgcga tcggcgacgt caccgcgcgc ccgcaactga cgcccgtcgc      1020
     gacgcgcgac ggcatgctgc tcgcggcgaa cctgttcggc ggcaagcgga tcgccgccga      1080
     tcatcgctac gttccttccg cggtgttcag ccagccggag atcgcgacgg tcgggctcac      1140
     cgaggcgcaa gcgcgcgccg agctcggcgc gctcgacatc tacaagacgt cgttccgcgc      1200
     gctgcggcac acgttgtccg gccgcgacga aaagacgttc atgaagctcg tcgtcgcgcg      1260
     cgacagccag cgcgtcgtcg gcgcgcacat ggtcgggcgc gacgcggcgg agatcatcca      1320
     gggcatcgcg atcgcgatcc gggcgggcgc gacgaaggcg cagttcgacg agacggtcgg      1380
     catccatcca accgcggccg aggagttcgt cacgttgcgg cagaaggagc cggacgacgc      1440
     atgacgcccg attggcgcgg tgcgcgacgg ctggtgtga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page