(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE489

CP000124.PE489       Location/Qualifiers
FT   CDS_pept        complement(504088..505611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48398"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ1"
FT                   /protein_id="ABA48398.1"
FT                   /translation="MIRADFHARTGESRRPGGLSRRLPAYRARRNRPFVAPVITPAVAH
FT                   RANRASCVVRLLLPQRDELLGRGWMDADRLVELRLRRARPDRDRDALDDLRRVAPDHVR
FT                   ADDALAVARDDELHERLFVAAGQRVPQRAERRLVDVERAELGARLRLGEPDRRDLRLAE
FT                   HRGRNVAMIGGDPLAAEQVRREQHAVARRDGRQLRARGDVADRVDRRHRRRRIGVDFDR
FT                   AVRVARDPDRLEPEPVAIRDAPRRIQHRVVRPVRALGEPERQPAVGAALDRLDRRARMD
FT                   GDTLLRHLAMQRVPHVVVEAAQDLLAAIEQVDIDAEPVEDARELDRDVAAADDRDPLRQ
FT                   LGQLERLARRDRVLDAGNRRQHRPRACRDGDVPGGDTPARDVDRMRADERRAPRMDLDA
FT                   RLVQQIDVDTAQARDLAVLRLDERRPRKQADVEGPAIARGVLDIVAVMRRVDEQLFRDA
FT                   AAQHAGAADALFLGDADARAVGRRDAAQAHAARARADDKEIVVEFHSVV"
     atgatccgag ccgattttca tgcgcgaacg ggcgaatcac gccgccccgg cggcctctcg        60
     cgccgcctgc ccgcctatcg cgcccgccgc aaccgcccgt tcgtcgcgcc cgtcatcaca       120
     ccagccgtcg cgcaccgcgc caatcgggcg tcatgcgtcg tccggctcct tctgccgcaa       180
     cgtgacgaac tcctcggccg cggttggatg gatgccgacc gtctcgtcga actgcgcctt       240
     cgtcgcgccc gcccggatcg cgatcgcgat gccctggatg atctccgccg cgtcgcgccc       300
     gaccatgtgc gcgccgacga cgcgctggct gtcgcgcgcg acgacgagct tcatgaacgt       360
     cttttcgtcg cggccggaca acgtgtgccg cagcgcgcgg aacgacgtct tgtagatgtc       420
     gagcgcgccg agctcggcgc gcgcttgcgc ctcggtgagc ccgaccgtcg cgatctccgg       480
     ctggctgaac accgcggaag gaacgtagcg atgatcggcg gcgatccgct tgccgccgaa       540
     caggttcgcc gcgagcagca tgccgtcgcg cgtcgcgacg ggcgtcagtt gcgggcgcgc       600
     ggtgacgtcg ccgatcgcgt ggatcgacgg caccgtcgtc gccgaatagg cgtcgacttc       660
     gatcgcgccg ttcgcgtcgc gcgcgacccc gaccgcctcg agcccgagcc cgtcgccatt       720
     cgcgacgcgc cccgtcgcat acagcaccgc gtcgtacggc ccgtacgcgc cctcggcgag       780
     cctgagcgtc aacccgccgt cggcgccgcg ctcgatcgcc tcgatcgtcg cgcgcgtatg       840
     gatggcgaca ccctgcttcg tcatctcgcc atgcaacgcg tgccgcacgt cgtcgtcgaa       900
     gccgcgcagg atctgctcgc cgcgatagaa caggtcgaca tcgacgccga gcccgttgaa       960
     gatgcccgcg aactcgaccg cgatgtagcc gccgccgacg atcgcgatcc gctgcggcag      1020
     ctcgggcaac tcgagcgcct cgcgcgacgt gatcgcgtgc tcgatgccgg gaatcggcgg      1080
     cagcaccggc cgcgagcctg tcgcgacggc gatgtgccgg gcggtgacac gccggcccgc      1140
     gacgtcgacc gtatgcgcgc cgacgagcgt cgcgcgcccc gtatggatct cgacgcccga      1200
     cttgttcagc agatcgacgt agataccgct caggcgcgcg atctcgcggt ccttcgcctc      1260
     gatgagcgtc ggccacgaaa acaggccgat gtcgaaggtc cagccatagc ccgcggcgtc      1320
     ctcgacatcg tggctgtaat gcgacgcgta gacgagcagc tttttcggga tgcagccgcg      1380
     cagcacgcag gtgccgccga tgcgctcttc ctcggcgatg ccgacgcgcg cgccgtagga      1440
     cgccgcgacg cggctcaggc gcacgccgcc cgagcccgcg ccgatgacaa agagatcgta      1500
     gtcgaattcc atagcgtcgt ctga                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page