(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE493

CP000124.PE493       Location/Qualifiers
FT   CDS_pept        507520..508191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49519"
FT                   /db_xref="GOA:Q3JWY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY7"
FT                   /protein_id="ABA49519.1"
FT                   /translation="MQISHKIAGAPRLAARAARAAGAWASAPAVRINRRTAPRSGVRGT
FT                   DNKTRTETEVDMFQMLPSMTFGRRLSVWWSCMWRQTLASAPVWILGVAIVGLSISRTHS
FT                   AAGRPPSGGAAALAVATFFVCLVVCLPIAGYMVRGGFAAHALTAPERLAFRQALMVGLT
FT                   TFGWAVLAALPISVATMPLRHAGYPLAGQAIGWVLNVAAGLYIVLPRQARRLRLLAGEA
FT                   A"
     gtgcaaatat cgcacaagat cgcgggcgcg ccgcgcttgg ccgcccgcgc cgcccgcgca        60
     gccggcgcct gggcgagcgc gccagccgta cgcatcaatc gtcgaaccgc gccgcgttcg       120
     ggcgttcgcg gcaccgataa caagacaaga acggaaacgg aggtcgatat gttccagatg       180
     ctgccgtcga tgacgttcgg ccgccgcctg tcggtgtggt ggtcctgcat gtggcgccag       240
     acgctcgcca gcgcgccggt atggatactc ggcgtcgcga tcgtcggatt gtcgatatcg       300
     cgaacccact ctgccgccgg tcggccgccg agcggcggcg cggcggcgct cgccgtcgcg       360
     accttcttcg tctgcctcgt cgtttgcctg ccgatcgccg gctacatggt gcgcggcggc       420
     ttcgccgcgc acgcgttgac ggcgcccgag cggctggcgt ttcggcaggc gctgatggtg       480
     gggctgacga cgttcggctg ggccgtgctg gccgcgctgc cgatcagcgt ggcgacgatg       540
     ccgctgcgcc atgccggcta tccgcttgcc ggccaggcga tcggctgggt gctgaacgtc       600
     gcggccggcc tgtacatcgt actgccgcgg caggcgcggc ggctgcggct gctcgcgggc       660
     gaagccgcgt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page