(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE494

CP000124.PE494       Location/Qualifiers
FT   CDS_pept        508281..509006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY6"
FT                   /protein_id="ABA49850.1"
FT                   /translation="MNRAIRMRAAVAAAAFSASLPAGAAGPAIDPGRYLYVEGGSAHGV
FT                   LTVKGNAFEIETIGGNCHTCALSGTFDGRVGIARDGENVCRIAVSGGHGDLRLDTSGSD
FT                   ACRDFCGMRASFDGEYRRPGAACTDRARDVRTERSHRQYAAHDYDAARTTLKALLAECG
FT                   GFMGWIELDRAKSDLALTEYHRGDRAQCVAVLSDTIAYRAQQDHSDAFGLPPCDADNYK
FT                   STGDAILHNLALCQAPAKR"
     atgaaccggg caatccgtat gcgggcggcg gtcgcggcgg ccgcgttttc agcaagcctc        60
     ccggcgggcg ccgccggccc cgcgatcgat ccgggccggt atctgtacgt cgaaggcggc       120
     agcgcgcacg gtgtgctgac cgtcaagggc aatgccttcg agatcgagac gatcggcggc       180
     aactgccata cctgcgcgct gagcggcacg ttcgacgggc gcgtgggcat cgcgcgcgac       240
     ggcgagaacg tatgccggat cgcggtgtcc ggcgggcacg gcgacctcag gctggatacg       300
     tccggctcgg atgcgtgccg ggatttctgc gggatgcgcg catcgttcga cggcgaatat       360
     cggcgcccgg gcgccgcgtg caccgatcgc gcccgggacg tacgcaccga gcgctcgcac       420
     cggcaatacg cggcgcacga ctacgatgcg gcgcgcacga cgctgaaggc gctgttggcc       480
     gaatgcggcg gcttcatggg ctggatcgag ctggaccgcg cgaagagcga cctggcgctg       540
     acggagtacc accgcggcga tcgagcccaa tgcgtggccg tgctgtccga tacgatcgcc       600
     tatcgcgcgc agcaggatca cagcgacgcg ttcggcctgc cgccgtgcga tgccgacaac       660
     tacaagtcga cgggcgacgc gatcctgcac aatctcgcgc tctgccaggc gccggcgaag       720
     cgctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page