(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE50

CP000124.PE50        Location/Qualifiers
FT   CDS_pept        complement(60153..60506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0056"
FT                   /product="YvlD"
FT                   /note="identified by match to protein family HMM PF04020"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47859"
FT                   /db_xref="GOA:Q3JY80"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY80"
FT                   /protein_id="ABA47859.1"
FT                   /translation="MTVILTWIINALALLIITYLVPSIHIKSFGTALIVAVVLGLINAV
FT                   IRPVLILLTLPVTIVTLGLFILVVNALCFWFASSLLKGFEVSGFWSAFFGSILYSIVSW
FT                   LLSALIFGQRNIG"
     atgaccgtca tcctgacctg gatcatcaac gcgctcgcgc tgttgatcat cacgtacctc        60
     gtaccgtcga tccacatcaa gagcttcggc acggcgctca tcgtcgcggt cgtgctgggc       120
     ctcatcaacg cggtgatccg gccggtcctg atcctgctca cgctgcccgt gacgatcgtc       180
     acgctcggcc ttttcatcct cgtcgtgaac gcgctgtgct tctggttcgc gtcgtcgctg       240
     ctgaaagggt tcgaagtgtc gggattctgg tccgcattct tcggttcgat cctgtacagc       300
     atcgtgtcgt ggctgctgtc cgccctgatc ttcggtcagc gcaacatcgg ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page