(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE502

CP000124.PE502       Location/Qualifiers
FT   CDS_pept        515266..515733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48422"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX8"
FT                   /protein_id="ABA48422.1"
FT                   /translation="MRAATCNPIASNIARRTANHGYFAALYSCAMKIVRLLLVLLWCAT
FT                   LPLTGLAASGLAGDCPMQQAMSMSEDGAMPSMQDCESMRSSVAGKSGKAGKAANVFCKV
FT                   MVQCQFGSLYHPMPAADVARPASPGRPLVFHYAKSLTVREPGGLWRPPRTA"
     ttgcgcgcgg cgacgtgcaa cccgatcgcg agcaacattg cgcgccgcac ggcgaaccac        60
     ggatacttcg ctgcgctata ctcttgcgcg atgaagatcg ttcgcctgct cctcgtgctg       120
     ctgtggtgcg cgacgctgcc cttgaccggg ctggcggcga gcggcctcgc cggcgattgc       180
     ccgatgcagc aggcgatgtc gatgagcgag gacggcgcga tgccgtcgat gcaggactgc       240
     gaatcgatgc gctcttcggt cgccggcaag tccggcaaag ccggcaaagc agcgaacgtc       300
     ttctgcaagg tgatggtgca atgccagttc ggcagtctct accatccgat gccggcggct       360
     gacgtggccc gccccgcgag cccgggccgc ccgctcgtct tccattacgc gaagtcgctc       420
     accgtccgcg aaccgggcgg gttgtggcga ccgccacgca ccgcctaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page