(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE513

CP000124.PE513       Location/Qualifiers
FT   CDS_pept        528327..529274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50793"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW7"
FT                   /protein_id="ABA50793.1"
FT                   /translation="MLAAVDGQRRARHAGRIREIARGVGDVVRARRAPADEPDDAYLRR
FT                   ERERLRRRRAMQRGLRERVRQPLGRRMKQRFVEQMNHDRTLAFVVARGVGRRVGERARE
FT                   HERRGDAARHRARERRVADVARGVRDGRGLRDHAGRPAERRAAIGDEPRDVRFDRQIGG
FT                   EHRRAAAERLDFGGERGGRAGFVARRGRERDVPAAPREADGERAADGRGVRRGPRGRRR
FT                   ARRLRLLLAGARGMCRRTGWRRCAGLRIARPAGADGLPRARPRRLGGARWRGARLHGAR
FT                   NQHDPRGAGRGCVAGVGWDGHLQCRDESESSRTR"
     atgctcgccg ccgtcgacgg tcagcgtcgc gcccgtcacg ccgggcgcat ccgcgagata        60
     gcacgcggcg tcggcgatgt cgtccgcgcg cggcgcgcgc ccgccgacga gcccgacgac       120
     gcgtaccttc ggcgcgagcg cgagcgcctg cgccgccgtc gcgcgatgca gcgcggcctg       180
     cgcgagcgag tgcgacagcc gctcgggcgc cggatgaaac agcgtttcgt cgagcagatg       240
     aatcacgacc gcacgctcgc gttcgtcgtc gcgcgcggcg tcgggcgtcg cgtcggcgag       300
     cgtgcgcgcg agcacgagcg gcgcggcgac gctgcgcgcc atcgcgcccg cgagcgacgc       360
     gtagccgacg tcgcgcgcgg tgtccgcgac gggcgcggcc tgcgcgatca cgcaggccgg       420
     ccggccgagc gccgcgccgc aatcggcgac gagccgcgcg acgtccgctt cgatcgccag       480
     atcggcggcg agcaccgccg cgcggcggcc gagcgcctcg acttcggcgg cgagcgcggc       540
     ggccgcgcgg gcttcgtcgc ccgccgcggc cgcgagcgcg acgttccagc cgcgccgcgc       600
     gaagccgacg gcgagcgcgc ggccgacggc cgcggcgtca ggcgcgggcc gcgcggccgg       660
     cggcgcgctc ggcgcttgcg cctgctgctc gccggcgcgc gggggatgtg ccggcgcacc       720
     ggctggcgcc gatgcgccgg gctgcgcatc gcccggccgg ccggcgccga tggcttgccg       780
     cgcgcccgcc cgcgccgcct cggcggcgcg cgctggcgcg gcgcccgtct gcacggcgcc       840
     cgtaatcagc acgacccgcg cggtgcgggc cgcggatgtg tcgcaggtgt cggctgggac       900
     ggtcatttac aatgccggga tgaatccgaa agctcacgaa cccgctag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page