(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE515

CP000124.PE515       Location/Qualifiers
FT   CDS_pept        530454..530648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0524"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49972"
FT                   /db_xref="GOA:Q3JWW5"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW5"
FT                   /protein_id="ABA49972.1"
FT                   /translation="MLRWLLTTFIAVMVLTRAWPWLAKLGVGRLPGDVTLRLGSRVYPF
FT                   PFMSTLVIMGIVSVIARLW"
     atgctgcgct ggctgctcac cacgttcatt gccgtgatgg tgctcacccg cgcgtggcct        60
     tggctcgcga agctcggcgt cggacggctg ccgggcgacg tgacgctcag gctcggctcg       120
     cgcgtctatc cgtttccgtt catgtcgacg ctcgtgatca tgggcatcgt atcggtgatc       180
     gcgcggctct ggtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page