(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE527

CP000124.PE527       Location/Qualifiers
FT   CDS_pept        complement(542124..543083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0536"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47592"
FT                   /db_xref="GOA:Q3JWV3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV3"
FT                   /protein_id="ABA47592.1"
FT                   /translation="MALPAVLQNLALPVIASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQLQTQLAEHKAANPDAVIGPIAVNQIVHQSNVRLEQDIRVCVEHKVPI
FT                   FITSLRAPAREIVDAVHGYGGIVLHDVINLRHAQKALEAGVDGLILVAAGAGGHAGTTS
FT                   PFALVGEVRRIFDGPIVLSGSIANGGSILAAQAMGADLAYMGTRFIATQEAHAVDAYKR
FT                   AILEAKSADIIYTNLFTGVHGNYIRESIVNAGLDPDALPESDKTKMNFGGDKAKAWKDI
FT                   WGAGQGVGLMDDVPSVAELVARLKREYDDAKARLGIRA"
     atggccctgc ccgccgtcct gcaaaacctc gcgctgcccg tcatcgcatc gccgatgttc        60
     atcgtcagct atccggagct cgtgctcgcg caatgcaagg cgggcatcgt cggctcgttt       120
     cccgcgctca acgcgcgccc ggccgaattg ctcgacgaat ggctcacgca gttgcagacg       180
     cagctcgccg agcacaaggc cgcgaacccg gacgccgtga tcgggccgat cgccgtgaat       240
     cagatcgtcc atcagtcgaa cgtgcggctc gagcaggaca tccgcgtatg cgtcgagcac       300
     aaggtgccga tcttcatcac gagcctgcgc gcgccggcgc gcgagatcgt cgacgcggtg       360
     cacggctacg gcggcatcgt gctgcatgac gtgatcaacc tgcggcacgc gcagaaagcg       420
     ctcgaagcgg gcgtcgacgg cctcatcctc gtcgccgcgg gcgcgggcgg ccacgcgggc       480
     acgacctcgc cgttcgcgct cgtcggcgaa gtgcgcagga tcttcgacgg cccgatcgtg       540
     ctgtccggct cgatcgcgaa cggcggctcg atccttgccg cgcaggcgat gggcgccgat       600
     ctcgcctaca tgggcacgcg cttcatcgcg acgcaggaag cgcacgcggt ggacgcgtac       660
     aagcgcgcga tcctcgaggc gaaatcggcc gacatcatct acacgaacct cttcaccggc       720
     gtgcacggca actacatccg cgagagcatc gtgaacgcgg ggctcgaccc ggacgcgctg       780
     cccgaatccg acaagacgaa gatgaatttc ggcggcgaca aggcgaaggc gtggaaggac       840
     atctggggcg cgggccaggg cgtcgggctg atggatgacg ttccgagcgt tgcggagctc       900
     gtcgcgcggc tcaagcgcga gtacgacgac gcgaaggcgc gcctggggat tcgcgcgtag       960
//

If you have problems or comments...

PBIL Back to PBIL home page