(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE529

CP000124.PE529       Location/Qualifiers
FT   CDS_pept        544330..545868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0539"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50576"
FT                   /db_xref="GOA:Q3JWV1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV1"
FT                   /protein_id="ABA50576.1"
FT                   /translation="MRRGAPRASILFARERRQAPRDGRRLDDRGARFRTLGHFREYSVE
FT                   LFDRVQIEPADEAIVARHLVAFDELRNPPQQLLDEMQLAGQRLHAHDRLQRVAERARIE
FT                   LDREARDHALRFEPAQPVGRARRGQPDAPREFADGLARVVGERAQQLAVDRIERVRRGK
FT                   RRGKAFLHGDLLFKGGKAFCAEFSDGDVRIKSLESKPGFLLARTHMASNPASSDARRGA
FT                   LEMVVAMLMSGTIGWLVVSSRQHLMNVVFFRCLFGGATMLIICAALGLLRRDLLTKRTI
FT                   AFALLGSVAIVANWVLLFAAYSRASISMATAVYNTQPFMLVALGALVFRERLTASAAAW
FT                   LVLAFGGLALVVRVEPAVLAVPGEYLEGVALALGAAFLYAVSSIVTKRLKGTPPHLIAL
FT                   FQTGVGVLALAPFVHYDALPATAGQWLDLVALGVVNTGIMYVLLYGAIQKLPTATIGAL
FT                   SFVYPVVAIVVDRFAFGQTLAWSQVGGAALILLAAAGVNLGWRIVPARRVAARG"
     gtgcggcgag gcgcgccgcg cgcgtcaatc ctcttcgcgc gcgagcggcg gcaggcgccg        60
     cgcgacgggc gtcgacttga cgatcgcggt gctcgtttcc gcacgctcgg tcactttcgc       120
     gagtattccg tcgagctgtt cgatcgagtg cagatagagc cggcagacga agcaatcgtc       180
     gcccgtcacc ttgtcgcatt cgacgaactc cggaatccgc cgcaacaact cctcgacgag       240
     atgcaactgg ccgggcagcg gcttcacgcg cacgatcgcc tgcagcgtgt agccgagcgc       300
     gcgcggatcg agctcgaccg tgaagcgcgc gatcacgccc tgcgcttcga gcctgcgcag       360
     ccggtcggcc gtgctcggcg cggacagccc gacgcgccgc gcgagttcgc tgacgggctg       420
     gcgcgcgtcg tcggcgagcg tgcgcagcag ctcgcggtcg atcgcatcga gcgtgttcgc       480
     cgcggcaaac ggcgtggaaa ggcgtttttg catggcgacc ttcttttcaa aggaggaaag       540
     gcgttttgtg ctgagtttag cgatggagat gtgcgaatca agtccctaga atcgaagcca       600
     ggctttcttc ttgcgagaac tcacatggct tcgaacccgg cttcgtccga cgcgcgccgc       660
     ggggcgctcg aaatggtggt cgcgatgctg atgtccggca cgatcggctg gctcgtcgtg       720
     tcgtcccggc agcatttgat gaatgtcgtg tttttccgct gcctgttcgg cggcgcgacg       780
     atgctgatca tttgcgccgc gctcggcctg ctgcgccgcg atctgctgac gaaacgcacg       840
     atcgcgttcg cgctgctcgg cagcgtcgcg atcgtcgcga actgggtgct gctgtttgcc       900
     gcgtattcgc gcgcgtcgat ctcgatggcg acggccgtgt acaacacgca gccgttcatg       960
     ctcgtcgcgc tcggcgcgct cgtgttccgc gagcggctca ccgcgtcggc cgccgcgtgg      1020
     ctcgtgctcg cgttcggcgg gctcgcgctc gtcgtgcgcg tcgagccggc ggtgctcgcg      1080
     gtgcccggcg agtatctcga gggcgtcgcc ctcgcgctcg gcgcggcgtt cctgtatgcg      1140
     gtgtcgtcga tcgtcacgaa gcgcttgaag ggcacgccgc cgcacctcat cgcgctgttc      1200
     cagacgggcg tcggcgtgct cgcgctcgcg ccgttcgtgc attacgacgc gctgcccgcg      1260
     acggcggggc agtggctcga tctcgtcgcg ctcggcgtcg tcaacacggg gatcatgtac      1320
     gtgctgctgt acggcgcgat ccagaagctg ccgaccgcga cgatcggggc gctgtcgttc      1380
     gtctatccgg tcgtcgcgat cgtcgtcgac cggttcgcgt tcgggcagac gctcgcatgg      1440
     agccaggtgg gcggcgcggc gctgatcctg ctcgcggcgg cgggcgtgaa tctcgggtgg      1500
     cggatcgtgc cggcgcgacg tgtcgcggcg cgcggctga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page