(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE531

CP000124.PE531       Location/Qualifiers
FT   CDS_pept        545121..547052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0540"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU9"
FT                   /protein_id="ABA49095.1"
FT                   /translation="MRRARPAAPRSADETHDRVRAARQRRDRRELGAAVCRVFARVDLD
FT                   GDGRVQHAAVHARRARRARVPRAAHRVGRRVARARVRRARARRARRAGGARGARRVSRG
FT                   RRPRARRGVPVCGVVDRHEALEGHAAAPHRAVPDGRRRARARAVRALRRAARDGGAVAR
FT                   SRRARRRQHGDHVRAAVRRDPEAADRDDRGAVVRLSGRRDRRRPVRVRADARMEPGGRR
FT                   GADPARGGGRESRVADRAGATCRGARLKAAHGCERASGRKAAAGASTKASAGESARERK
FT                   GAQGSARERALRHSDTRNKVVGKFLMRCSEGARMMRSDVDHVHRILIRYAVRLSGRTVF
FT                   FCARDGAPGARRARLTRLAAWRCARAPYASRRRRACATRRSRRACGGSLRTSRSLHRFG
FT                   RHSCTAMAPPRSAWRFPYPSSISRRSRSCRHPRTRRPAHALPHRAWAPCPARRRRASRR
FT                   AFPSHGSCVAALRDVGDRRARERHELLRRQVEHRVRMARRGPQAVEIEQVAIDQHHGLD
FT                   EMADRAHAADRVAGVVAHELRVRAADFADLCGDLPFVDAVRAARDDEHRRAVGAAPEQD
FT                   RFRDLRDRAAEARGGLGRSLAGFLEHHDRLRMPALAQQQRDAASGIGKLVDGGGGSHGC
FT                   ASSPRWVG"
     ttgcgccgcg ctcggcctgc tgcgccgcga tctgctgacg aaacgcacga tcgcgttcgc        60
     gctgctcggc agcgtcgcga tcgtcgcgaa ctgggtgctg ctgtttgccg cgtattcgcg       120
     cgcgtcgatc tcgatggcga cggccgtgta caacacgcag ccgttcatgc tcgtcgcgct       180
     cggcgcgctc gtgttccgcg agcggctcac cgcgtcggcc gccgcgtggc tcgtgctcgc       240
     gttcggcggg ctcgcgctcg tcgtgcgcgt cgagccggcg gtgctcgcgg tgcccggcga       300
     gtatctcgag ggcgtcgccc tcgcgctcgg cgcggcgttc ctgtatgcgg tgtcgtcgat       360
     cgtcacgaag cgcttgaagg gcacgccgcc gcacctcatc gcgctgttcc agacgggcgt       420
     cggcgtgctc gcgctcgcgc cgttcgtgca ttacgacgcg ctgcccgcga cggcggggca       480
     gtggctcgat ctcgtcgcgc tcggcgtcgt caacacgggg atcatgtacg tgctgctgta       540
     cggcgcgatc cagaagctgc cgaccgcgac gatcggggcg ctgtcgttcg tctatccggt       600
     cgtcgcgatc gtcgtcgacc ggttcgcgtt cgggcagacg ctcgcatgga gccaggtggg       660
     cggcgcggcg ctgatcctgc tcgcggcggc gggcgtgaat ctcgggtggc ggatcgtgcc       720
     ggcgcgacgt gtcgcggcgc gcggctgaag gcggcgcacg ggtgcgagcg cgcaagcggg       780
     cgcaaggcag ccgcgggagc gagcacaaag gcgagcgcag gagagagcgc aagggagcgc       840
     aagggagcgc aagggagcgc aagggagcgc gcgctgcgac attccgacac gcgcaataaa       900
     gttgtaggga aattcctgat gcggtgcagc gagggcgctc gtatgatgcg cagtgacgtt       960
     gatcacgtcc acagaattct cattcgatac gccgttcgcc tgtcaggtcg gacggttttt      1020
     ttttgcgcgc gcgacggcgc acccggcgca cgccgcgcgc ggctcacgcg gctcgccgcg      1080
     tggcgatgcg cgcgagcacc gtacgcttcg cgtcgtcgtc gagcttgcgc cacgcggcga      1140
     tctcgtcgcg cgtgcggcgg cagccttcgc accagccggt ccttgcatcg attcggcaga      1200
     cattcgtgca cggcgatggc acccccccgc tcggcgtggc gttttccgta cccgagttcg      1260
     atctcgcggc gttcgcgttc gtgccggcat ccgcgcacgc gccggccggc gcatgcgttg      1320
     ccgcatcggg cgtgggcgcc gtgtccggcg cgcaggcggc gagcgtcgcg ccgcgcgttt      1380
     ccgtcacatg gctcatgcgt cgccgcgctg cgcgacgtcg gcgaccggcg cgcccgtgag      1440
     cgacacgagc tcctgcggcg acaggttgaa caccgcgtgc ggatggcccg ccgcggccca      1500
     caggctgtcg agatcgagca ggtcgcgatc gatcagcacc acgggctcga cgagatggcc      1560
     gatcgggcac acgccgccga tcgcgtagcc ggtgttgtcg cgcacgaact tcgcgtccgc      1620
     gcggccgact tcgccgacct gtgcggcgac cttcctttcg tcgacgcggt tcgcgccgct      1680
     cgcgacgacg agcaccggcg cgccgtcggc gcggcgccgg aacaggatcg atttcgcgat      1740
     ctgcgcgatc gagcagccga ggcccgcggc ggcctcggcc gaagtcttgc cggtttcctc      1800
     gagcatcacg atcgccttcg catgcccgcg ctcgcgcagc agcagcgcga cgcggcgagc      1860
     ggaatcggga agcttgtcga tgggggcggg ggtagccatg ggtgcgcttc gtctcctcgc      1920
     tgggtggggt ga                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page