(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE538

CP000124.PE538       Location/Qualifiers
FT   CDS_pept        complement(550287..550697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0547"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47487"
FT                   /db_xref="GOA:Q3JWU2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="PDB:4DYW"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU2"
FT                   /protein_id="ABA47487.1"
FT                   /translation="MQHTEQPRVGCGAAIVRDGRILLIKRKRAPEAGCWGLPGGKVDWL
FT                   EPVERAVCREIEEELGIALERATLLCVVDHIDAANGEHWVAPVYLAHAFSGEPRVVEPD
FT                   RHEALGWFALDDLPQPLTHATRIALEQVTRAA"
     atgcaacaca ccgaacaacc gcgcgtcggc tgcggcgccg ccatcgtccg cgacggccgg        60
     attctgctga tcaagcgcaa gcgcgcgccc gaggccggct gctggggcct gccgggcggc       120
     aaggtcgact ggctcgagcc cgtcgagcgc gcggtgtgcc gggaaatcga ggaggaactg       180
     gggatcgcgc tcgagcgcgc cacgctgttg tgcgtcgtcg atcacatcga cgccgcgaac       240
     ggcgagcatt gggtcgcgcc cgtctatctc gcgcacgcgt tcagcggcga gccgcgcgtc       300
     gtcgaaccgg acaggcacga ggcgctcggc tggttcgcgc tcgacgatct gccgcagccg       360
     ctcacgcatg cgacgcgcat cgcgctcgag caggtcacac gagcagcctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page