(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE540

CP000124.PE540       Location/Qualifiers
FT   CDS_pept        complement(550835..552952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0549"
FT                   /product="non-hemolytic phospholipase C precursor"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by match to protein family HMM PF04185;
FT                   match to protein family HMM PF05506"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49869"
FT                   /db_xref="GOA:Q3JWU0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU0"
FT                   /protein_id="ABA49869.1"
FT                   /translation="MTSESRRRFLHTVAQSAGAAAALTVFPESIRRALAIPAASRTGTL
FT                   RDVEHIVVFMQENRSFDHYFGHLRGVRGYNDRFPIPLPNGKPVWYQPSKANPGKPVLPF
FT                   RLNTLTTSAQCIGDLDHSWYKTHAAIDGGRYDQWPANKTDMTMGYHVREDIPFHYALAD
FT                   AFTVCDNYFCSLPGPTHPNRSYLMTGTVDPTGRYGGPLLDNSDYVDGDVPPKYDLLTWT
FT                   TYPERLEANGISWQIYQQGTTGADPLNGNYGTNILQNFANFINAKPGSSLYRRAQTART
FT                   LDDLKADVLANKLPQVSWLLPPAAFSEHPRYTPAYGANYTSQILDALTSNPDVWRKTVL
FT                   FIMYDENDGFFDHVVPPQPATTRAQGLSTVTVDGEIHDVVNPGRGGSYTADGLPYGLGP
FT                   RVPMTVVSPWTKGGFVCSQVFDHTSVIRFIAARFGIDEPNITPWRRAVCGDLTSAFDFR
FT                   TPDATLPPLPDTSGYRSIADQLCSTKPAPAVPAAPSPVDPQEPGVRPARALPYELHVNA
FT                   EVHGGARLRIEFANRGEQGAHFYVYASNRSDGPWRYTVGAHRSLHETFDLAATNGAYAF
FT                   AVYGPNGFVRVFEGLAAAGGHGRQAAARPEVKAGYDVANGNLYLKLANHGAQSVQLTLA
FT                   DNAYGAPARRITLRGGDEQIESWALASSHQWYDVTVSDGATGQFVRRFAGHVENGKPSY
FT                   SDPAAIAPVTG"
     atgacatcag aaagccgccg ccgtttcctg cataccgtcg cgcaatccgc gggcgccgcc        60
     gccgcgctca ccgtgtttcc cgaatcgatt cgccgcgcac tcgcgattcc cgccgcgtcg       120
     cgcacgggca cgctgcgcga tgtcgagcac atcgtcgtgt tcatgcagga aaaccgctcg       180
     ttcgaccatt acttcggaca cctgcgcggt gtgcgcggct acaacgaccg ctttccgatt       240
     ccgctgccga acggcaaacc ggtctggtat cagccgtcga aggcgaatcc gggcaagccg       300
     gtgctgccgt ttcgcctgaa cacgctgacg acgagcgcgc agtgcatcgg cgatctcgat       360
     cactcgtggt acaagacgca tgcggcgatc gacggcggcc gctacgatca gtggcccgcg       420
     aacaagaccg acatgacgat gggctaccac gtgcgcgagg acatcccgtt ccactacgcg       480
     ctcgccgacg cgttcaccgt ctgcgacaac tacttctgct cgctgccggg cccgacgcat       540
     ccgaaccgct cgtatctgat gacgggcacg gtcgatccga ccggccggta cggcggcccg       600
     ctgctcgaca acagcgatta cgtggacggc gacgtgccgc cgaaatacga tctgctcacc       660
     tggacgacgt accccgaacg cctcgaggcg aacggcattt cgtggcagat ctatcagcag       720
     ggcacgacgg gggccgatcc gctgaacggc aactacggga cgaacatcct gcagaacttc       780
     gcgaacttca tcaacgcgaa gccgggctcg tcgctgtatc ggcgcgcgca gaccgcgcgc       840
     acgctcgacg atctgaaggc cgacgtgctc gcgaacaagc tgccgcaggt gtcgtggctg       900
     ctgccgcccg cggcgttctc cgagcatccg agatacacgc ccgcgtacgg cgcgaactac       960
     acgtcgcaga tcctcgacgc gctgacgtcg aaccccgacg tgtggcgcaa gaccgtgctc      1020
     ttcatcatgt acgacgagaa cgacggcttc ttcgatcacg tcgtgccgcc gcagccggcg      1080
     acgacgcgcg cgcagggcct gtcgaccgtg accgtcgacg gcgagatcca cgacgtcgtg      1140
     aacccgggcc gcggcggcag ctacacggcc gacggcctgc cgtacggcct cggcccgcgc      1200
     gtgccgatga cggtcgtgtc gccgtggacg aagggcggct tcgtgtgctc gcaggtgttc      1260
     gaccatacgt cggtgatccg cttcatcgcc gcgcgcttcg gcatcgacga gccgaacatc      1320
     acgccgtggc gccgcgcggt gtgcggcgat ctcacgtcgg cgttcgactt ccgcacgccg      1380
     gacgcgacgc tgccgccgtt gcccgacacg agcggctatc ggtcgatcgc cgatcagctc      1440
     tgctcgacga agcccgcgcc cgccgtgccc gccgcgccga gccccgtcga tccgcaggag      1500
     cccggcgtgc gcccggcgcg cgcgctgcct tacgagctgc acgtgaacgc cgaggtgcac      1560
     ggcggcgcgc gcctgcgcat cgagttcgcg aatcgcggcg agcaaggcgc gcacttctat      1620
     gtgtacgcat cgaatcgcag cgacggcccg tggcgctaca cggtcggcgc gcaccgctcg      1680
     ttgcacgaaa cgttcgatct cgccgcgacg aacggcgcgt acgcgttcgc cgtgtatggt      1740
     ccgaacggct tcgtgcgcgt gttcgaaggc ctcgccgcgg ccggaggcca cggccggcaa      1800
     gcggccgcgc gccccgaggt gaaggcgggc tacgacgtcg cgaacggcaa cctgtatctg      1860
     aagctcgcga atcatggcgc acagagcgtg caactgacgc tcgccgacaa cgcgtacggc      1920
     gcgccggcgc gccggatcac gctgcgcggc ggcgatgagc agatcgaatc gtgggcgctg      1980
     gcgtcgagcc atcaatggta tgacgtgacg gtgtcggacg gcgcgaccgg ccagttcgtg      2040
     cgccgcttcg cggggcacgt cgagaacggc aagccgagct attccgatcc ggcggcgatc      2100
     gcgcccgtca cgggctga                                                    2118
//

If you have problems or comments...

PBIL Back to PBIL home page