(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE551

CP000124.PE551       Location/Qualifiers
FT   CDS_pept        565897..566910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0560"
FT                   /product="sulfate-binding protein precursor"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48448"
FT                   /db_xref="GOA:Q3JWS9"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS9"
FT                   /protein_id="ABA48448.1"
FT                   /translation="MKHNKGIGRRLAAGVAAALLATAAHADTALLNVSYDVTRELYKDI
FT                   NASFVAAYKQKTGETVSVRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAERGQLL
FT                   PKNWRTRLPNGSSPYSTTMVFLVRHGNPKQIKDWSDLAKPGVQVIIANPKTSGNGRYAY
FT                   LAAWGYQKLKGATDQQALDFEKAIFRNVPVLDSGGRGATTTFTQRGIGDVLVTFENEVA
FT                   LIDSGAAGASFDAVYPSASILAEPPVAIVDKVVDKKGTRRAAQAYLDYLYSPAAQEIVA
FT                   QHHLRPRDPNVLKQHASEFKPLKTFTVEQIFGNWANAQKTHFADGGTFDKIIVDRK"
     atgaagcaca acaagggaat cggccgtcgg ctcgcggccg gcgtcgccgc ggcgctgctc        60
     gcgacggccg cgcatgcgga cacagcgctg ttgaacgtgt cctacgacgt cacgcgcgaa       120
     ctgtacaagg acatcaacgc gagcttcgtc gccgcataca agcagaagac gggcgagacg       180
     gtatcggtgc ggcagtcgca cggcgcgtcg agcgcgcagg cgctgtcggt gctgcagggg       240
     ttgcaggccg acgtcgtgac gatgaaccag ccgaacgaca tcgatctgct cgccgagcgc       300
     ggccagttgc tgccgaagaa ctggcgcacg cgtctgccga acggcagctc gccgtactcg       360
     acgacgatgg tgttcctcgt gcgccacggc aacccgaagc agatcaagga ctggagcgat       420
     ctcgcgaaac ccggcgtgca ggtgatcatc gcgaatccga agacctcggg caacggccgc       480
     tacgcgtatc tcgccgcgtg gggctaccag aagctcaagg gcgcgaccga tcagcaggcg       540
     ctcgatttcg agaaggcgat cttccgcaac gtgccggtgc tcgattccgg cggccggggt       600
     gcgacgacga cgttcacgca gcgcggcatc ggcgacgtgc tcgtcacgtt cgaaaacgag       660
     gtcgcgctga tcgattcggg cgcggcgggc gcgagcttcg atgcggtcta tccgtctgcg       720
     agcattctcg cggagccgcc cgtggcgatc gtcgacaagg tcgtcgacaa gaaaggcacg       780
     cgccgcgccg cgcaggcgta cctcgactat ctgtattcgc ccgccgcgca ggagatcgtc       840
     gcgcagcatc atctgcgtcc gcgcgatccg aacgtgctga agcagcacgc gagcgagttc       900
     aagccgctca agacgttcac cgtcgagcag atcttcggca actgggcgaa cgcgcagaag       960
     acgcatttcg ccgacggcgg cacgttcgac aagatcatcg tcgatcgcaa gtag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page