(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE552

CP000124.PE552       Location/Qualifiers
FT   CDS_pept        567455..569104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0561"
FT                   /product="serine-type carboxypeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00450"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49456"
FT                   /db_xref="GOA:Q3JWS8"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS8"
FT                   /protein_id="ABA49456.1"
FT                   /translation="MPATAAVAAALLLALGGCGDDLQSTTTPAQLNQPYTDTTAYSPKA
FT                   GDGLPASQVSERAAVMSHQWTANGASVDYLTTTGHLTATDPNGNAEATMSYVAYTAPSR
FT                   DGSPRPVTFFYNGGPGSSSVWLRLGSFAPTRVATPDPLMTNWPNFPLVDNPESLIATTD
FT                   MVFIDPPGTGLSEAIQPNTNQTFWGADADVKVMRDFIRRYLSVNGRGGSPIYLYGESYG
FT                   TPRTDMLALALESAGVPLTGIVLQSSILNYMAAAGDQAVGTFPSYAQVAAYFNQVSPSP
FT                   TNLGAYAQRIENFVTAQYAPIVHYATASSPISPDAGTLAAWSSQTGMATASIGAYFQYF
FT                   YDTEPSPGQTTLVPGYTIGRYDGRVSLPNGDARLASDDDPSDILISKPFTSALASQMPN
FT                   YLGYTAPNATYQTLNPDIIGVWNFSHAGQPYPDTIPDLLAALQLNPKLKVLASNGYHDL
FT                   ATPYFETEKELARLQTVSGLAPNLQVTFYQGGHMIYLDDVARPQMQADLVAFYQNRPVA
FT                   NALTLAALPSPWPDESPANTPTAKIARAAAAR"
     atgccggcga cggccgccgt tgccgccgcg ttgctgctcg cgctcggcgg gtgcggcgac        60
     gatctgcaga gcaccacgac gcccgcgcag ctcaatcaac cgtacacgga cacgaccgcg       120
     tattcgccga aggcgggcga tgggctgccg gcgtcgcagg tatccgaacg cgccgcggtg       180
     atgagccacc agtggacggc gaacggcgcg agcgtcgatt acctgacgac gaccggccac       240
     ctgacggcca ccgatccgaa cggcaacgcg gaggcgacga tgtcgtacgt cgcgtatacg       300
     gcgccgagcc gcgacggctc gccgcggccc gtcacgttct tctataacgg ggggccgggc       360
     tcgtcgtcgg tgtggctgcg gctcggctcg ttcgcgccga cgcgggtcgc gacgcccgat       420
     ccgctgatga cgaactggcc gaatttcccg ctcgtcgaca acccggagag cctgatcgcg       480
     accaccgaca tggtgttcat cgatccgccg ggcacgggcc tgtcggaggc gatccagccg       540
     aacacgaacc agacgttctg gggagcggac gccgacgtga aggtgatgcg cgatttcatt       600
     cgccgctacc tgtcggtcaa cggccgcggc ggctcgccga tctatctgta cggcgaatcg       660
     tacggcacgc cgcgcacgga tatgctcgcg ctcgcgctcg aatcggcggg cgtgccgctc       720
     acgggcatcg tgctgcagtc gtcgatcctg aactacatgg cggccgcggg cgaccaggcg       780
     gtgggcacct ttccgtcgta cgcgcaggtg gccgcatact tcaaccaggt gtcgccgtcg       840
     ccgacgaatc tgggcgcgta tgcgcagcgc atcgagaatt tcgtgaccgc gcagtacgcg       900
     ccgatcgtgc attacgcgac ggcttcgtcg ccgatctcgc cggacgccgg cacgctcgcc       960
     gcgtggtcgt cgcaaacggg catggccacc gcgtcgatcg gcgcgtactt ccagtatttc      1020
     tacgatacgg agccgtcgcc cggccagacg acgctcgtgc ccggctacac gatcggccgc      1080
     tacgacggcc gcgtgtcgct gccgaacggc gacgcgcgcc tcgcgagcga cgacgatccg      1140
     tccgacatcc tgatctcgaa gccgttcacg agcgcgctcg cgtcgcagat gccgaactac      1200
     ctcggctaca ccgcgccgaa cgcgacgtat cagacgctca atcccgacat catcggcgtg      1260
     tggaacttca gccacgcggg ccagccgtat ccggacacga tcccggatct gcttgccgcg      1320
     ctgcaactga atccgaagct gaaggtgctc gcgtcgaacg gctatcatga tctcgcgacg      1380
     ccgtacttcg aaacggagaa ggagctcgcg cggctgcaga cggtgtccgg cctcgcgccg      1440
     aatctgcagg tgacgttcta ccagggcggc cacatgatct atctcgacga cgtcgcgagg      1500
     ccgcagatgc aggcggatct cgtcgcgttc taccagaacc ggccggtggc aaacgcgttg      1560
     acgctcgcgg cgctgccgtc gccgtggccc gacgaaagcc cggcgaacac gccgacggcg      1620
     aagatcgcgc gggccgccgc ggcccgctga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page