(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE560

CP000124.PE560       Location/Qualifiers
FT   CDS_pept        583257..583970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0569"
FT                   /product="CutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50848"
FT                   /db_xref="GOA:Q3JWS0"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS0"
FT                   /protein_id="ABA50848.1"
FT                   /translation="MPASSILLEVIATTIGDARAAARAGADRIELVTAISEGGLTPSVG
FT                   VIEAVVAAVPIPVNVIVRPHSRSFSYDASELAAIARDVRAAVAAGANGIVFGMLDAHGD
FT                   IDLDALRRIADAADGRDLTFHRAFDVARDLNAAFDTLLRVPSVTSVLTSGGHPSVLDAR
FT                   DVVARMVRRAAGAACTVLAGAGLTVDALGDFVRATGVRAVHFGSGVRERGEVLAPIDER
FT                   LVAKARAALDAATRG"
     atgccagctt cctcgatcct tctcgaagtc atcgcgacga cgatcggcga cgcgagagcc        60
     gccgcgcgcg cgggggccga tcgcatcgag ctcgtgaccg cgatcagcga gggcggcctg       120
     acgccgagcg tcggcgtgat cgaagccgtc gtcgccgcgg tgccgattcc cgtcaacgtg       180
     atcgtgcgcc cgcacagccg ctcgttcagt tacgacgcga gcgaactcgc ggcgatcgcg       240
     cgcgacgtgc gcgcggccgt cgcggcgggc gcgaacggca tcgtgttcgg gatgctcgac       300
     gcgcacggcg acatcgatct cgacgcgttg cggcgcatcg ccgacgcggc cgacgggcgc       360
     gatctcacgt tccaccgcgc gttcgacgtc gcgcgcgatc tgaacgccgc attcgatacg       420
     ttgctgcgcg tgccgtccgt cacgtcggtg ctgacctcgg gcggacatcc gtcggtgctc       480
     gacgcgcgcg acgtcgtcgc gcggatggtg cggcgcgccg cgggcgcggc gtgcacggtg       540
     ctcgcgggcg cggggctcac cgtcgatgcg ctcggcgatt tcgtgcgcgc caccggcgtg       600
     cgggccgtgc atttcggctc gggcgtgcgc gagcgtggcg aggtgctcgc gccgatcgac       660
     gagcggctcg tcgcgaaggc gcgcgcggcg ctcgatgcgg cgacgcgggg gtag             714
//

If you have problems or comments...

PBIL Back to PBIL home page