(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE568

CP000124.PE568       Location/Qualifiers
FT   CDS_pept        complement(590501..590953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48135"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR2"
FT                   /protein_id="ABA48135.1"
FT                   /translation="MQPTTNAPERPLDCPCGGAAPGANANARAPRYADCCARLIDGHAT
FT                   AATALELMRSRYSAYVLGATDYLRATWDPSTCPAELDADTGRAHAPRWLGLVIKRHAQL
FT                   DATHAEVEFVARYKIGGRAHRMHETSRFTRDAQGAWRYVDGDVSER"
     atgcaaccca cgacgaacgc ccccgagcgc cccctcgact gcccgtgcgg cggcgccgcg        60
     cccggcgcga acgcgaacgc gcgcgcgccg cgctacgcgg attgctgcgc ccgcctgatc       120
     gacgggcacg ccaccgcggc aacggcgctc gagctgatgc gctcgcgcta cagcgcatac       180
     gtgctcggcg ccaccgatta tctgcgcgcg acctgggacc cgagcacctg cccggccgag       240
     ctcgacgccg acaccggccg cgcgcacgcg ccgcgctggc tcggcctcgt gatcaagcgc       300
     cacgcgcaac tcgacgcgac gcacgccgaa gtggaattcg tcgcgcgcta caaaatcggc       360
     gggcgcgcgc accggatgca cgagacgagc cgtttcacgc gcgacgcgca aggcgcgtgg       420
     cgctacgtcg acggcgatgt aagcgagcgc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page