(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE577

CP000124.PE577       Location/Qualifiers
FT   CDS_pept        complement(601631..602125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0586"
FT                   /product="MarR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47606"
FT                   /db_xref="GOA:Q3JWQ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ3"
FT                   /protein_id="ABA47606.1"
FT                   /translation="MHMHFVRHRMLVVDKRFQRLPMSDAPMRLPCHCGTLRQATRAITS
FT                   LYDAHLARHGIRITQFTILAALHGGDALPTGELATRLLLDQTTLSRTLATLQSNQLVRA
FT                   ESGDDQRVRLWSLTPKGTALFKAARVDWEAAQNDVSRRIGKRNMQALDAGIFALAKALS
FT                   N"
     atgcatatgc attttgtacg tcatagaatg ctcgtcgtcg acaaacgctt tcaaaggctc        60
     ccgatgagcg acgctccgat gagactcccg tgccactgcg gcacgctgcg ccaggccacg       120
     cgcgcgatca cgtcgctcta cgacgcgcat ctcgcgaggc acggcatccg catcacgcaa       180
     ttcacgatac tcgcggcact gcacggcggc gatgcgctgc cgaccggcga actcgcgacg       240
     cgcctgctgc tcgaccagac cacgctgagc cgcacgctcg cgacgctgca atcgaaccag       300
     ctcgtgcgcg ccgaatccgg cgacgaccag cgcgtgcgcc tctggagcct cacgccgaag       360
     ggcaccgcgc tgttcaaggc ggcccgcgtc gactgggagg ccgcgcagaa cgacgtgtct       420
     cggcgcatcg gcaaacgaaa catgcaggcg ctcgatgccg gcattttcgc gctcgccaag       480
     gcgctctcga actga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page