(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE578

CP000124.PE578       Location/Qualifiers
FT   CDS_pept        complement(602100..603743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48664"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ2"
FT                   /protein_id="ABA48664.1"
FT                   /translation="MPRRRDRERRHQQGRDHGRRRSGRVPRDHGRQLLRDDRDVRAVHR
FT                   ADDGRAARHARRHRERGRRARAAGLGRVQRVEGGGDQVSRSAEGRAAARASRGRDDRAR
FT                   LHPHADDRAQPVSDAVPDGCGPLREARGARDLAENRVSRDSMADGHRREAAARDAALAV
FT                   RSPVREGAAQTQGEGGLSGADAGARRDPHARRRRAALPPCATPFIHSSIRPFVPNAGAA
FT                   RAPRAAVSPSRARRRLRVDRRLGRQPRLHVARQRIDEHFVAAGRERVERLPDDVLRAIL
FT                   RHALRVRDHVGIDIRRMQREHARALLAQLVADRVRRGPRGRLRNAVRARIRQAEPRQHR
FT                   QHVDDRAAAVLAQHRRERTRHRERAEEIRVELRLQAAAVRLREQRAHSENARVVDEQID
FT                   VAQLARGGGDILRARDVEPHRLHAGRRHARRIARGRIDFLRARGLQPLDEREPQAAIRA
FT                   GHQYDGIIQIHLDSLQQDPGFARRPPAAACLVQACAAPRTPRRTAQPTHGSPPNRCGRI
FT                   DSANGASRTRCYTETPSPAGAKHAYAFCTS"
     gtgccccgac gtcgtgatcg cgaacgccgg catcagcaag ggcgcgatca cgggcgaagg        60
     cgatctggcc gcgttccgcg agatcatgga cgtcaactac tacgggatga tcgcgacgtt       120
     cgagccgttc atcgcgccga tgacggccgc gcggcgcggc acgctcgtcg gcatcgcgag       180
     cgtggccggc gtgcgcgggc tgccgggctc gggcgcgtac agcgcgtcga aggcggcggc       240
     gatcaagtat ctcgaagcgc tgagggtcga gctgcggccc gcgcaagtcg cggtcgtgac       300
     gatcgcgccc ggctacatcc gcacgccgat gaccgagcac aacccgtatc cgatgccgtt       360
     cctgatggat gcggaccgct tcgcgaagcg cgcggcgctc gcgatctcgc agaaaaccgc       420
     gtttcgcgtg attccatggc agatgggcat cgtcgcgaag ctgctgcacg tgatgccgcg       480
     ctggctgtac gatcgcctgt tcgagaaggc gccgcgcaaa cccagggcga aggcgggctg       540
     agcggggccg acgccggcgc gcgccgcgat ccgcacgcac gacggcggcg agccgccctg       600
     ccgccctgcg cgacaccgtt catccattca tccattcgcc cgttcgtccc gaacgccggt       660
     gccgcacgcg cgccgcgtgc cgccgtatca ccgtcacgcg cccgtcggcg gctgcgtgta       720
     gaccgccggc tcggccgaca accccgcctt cacgtcgcgc gtcagcgcat cgacgagcac       780
     ttcgtcgcgg ccggccgcga gcgcgtcgag cgtctgccgg acgacgtcct ccgggcgatt       840
     cttcggcacg ccctgcgcgt gcgcgaccat gtcggtatcg atatacgccg aatgcagcgc       900
     gagcacgcgc gtgcgctgct cgcgcagctc gttgcggatc gcgttcgtcg cggcccacgc       960
     ggccgccttc gaaatgccgt acgcgcccgt attcggcaag ccgagccacg acagcaccga      1020
     cagcacgttg atgatcgcgc cgccgccgtt ctcgcgcagc accggcgcga acgcacgcgc      1080
     catcgcgagc gggccgaaga aattcgtgtc gagctgcgcc tgcaggccgc cgccgtccgc      1140
     ctccgcgagc agcgagccca ttcggaaaat gcccgcgttg ttgacgagca gattgacgtc      1200
     gcgcaactcg cgcgcggcgg cggcgatatc ttgcgcgcgc gtgacgtcga gccgcaccgg      1260
     ctgcacgccg ggcgtcgtca cgcgcgccgg atcgcgcgcg gccgcataga ttttcttcgc      1320
     gcccgcggcc ttcagcccct cgacgaacgc gagccccagg ccgcgattcg cgccggtcac      1380
     cagtacgacg gcatcattca gattcatctc gactctctcc agcaagaccc aggattcgcg      1440
     cgacgcccgc ctgccgccgc ctgtctcgtc caagcgtgcg ccgcgcctcg aacgccgcgg      1500
     cgcacggctc aaccgacgca cggctcgccg ccgaatcgat gcgggcgcat cgattcggcc      1560
     aatggcgcgt cacgcacccg atgctacacc gaaacgcctt cgccggccgg cgcaaaacat      1620
     gcatatgcat tttgtacgtc atag                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page