(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE580

CP000124.PE580       Location/Qualifiers
FT   CDS_pept        complement(603203..603982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0589"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47957"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ0"
FT                   /protein_id="ABA47957.1"
FT                   /translation="MNAPAPLKVFITGASSGLGLALAAEYARHGATLGLVARRADALAE
FT                   FAPRFPKASISIYPADVRDADALALAASRFVAAHGCPDVVIANAGISKGAITGEGDLAA
FT                   FREIMDVNYYGMIATFEPFIAPMTAARRGTLVGIASVAGVRGLPGSGAYSASKAAAIKY
FT                   LEALRVELRPAQVAVVTIAPGYIRTPMTEHNPYPMPFLMDADRFAKRAALAISQKTAFR
FT                   VIPWQMGIVAKLLHVMPRWLYDRLFEKAPRKPRAKAG"
     atgaacgccc ctgccccgct caaggtcttc atcaccggcg cctccagcgg gctcggcctc        60
     gcgctcgccg ccgaatacgc gcggcacggc gcgacgctcg gcctcgtcgc ccggcgcgcc       120
     gacgcgctcg ccgagttcgc gccacgcttt cccaaggcct cgatctcgat ctacccggcc       180
     gacgtgcgcg acgccgatgc gctcgcgctc gccgcgtcgc gcttcgtcgc cgcgcacggg       240
     tgccccgacg tcgtgatcgc gaacgccggc atcagcaagg gcgcgatcac gggcgaaggc       300
     gatctggccg cgttccgcga gatcatggac gtcaactact acgggatgat cgcgacgttc       360
     gagccgttca tcgcgccgat gacggccgcg cggcgcggca cgctcgtcgg catcgcgagc       420
     gtggccggcg tgcgcgggct gccgggctcg ggcgcgtaca gcgcgtcgaa ggcggcggcg       480
     atcaagtatc tcgaagcgct gagggtcgag ctgcggcccg cgcaagtcgc ggtcgtgacg       540
     atcgcgcccg gctacatccg cacgccgatg accgagcaca acccgtatcc gatgccgttc       600
     ctgatggatg cggaccgctt cgcgaagcgc gcggcgctcg cgatctcgca gaaaaccgcg       660
     tttcgcgtga ttccatggca gatgggcatc gtcgcgaagc tgctgcacgt gatgccgcgc       720
     tggctgtacg atcgcctgtt cgagaaggcg ccgcgcaaac ccagggcgaa ggcgggctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page