(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE587

CP000124.PE587       Location/Qualifiers
FT   CDS_pept        611912..612049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0596"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP3"
FT                   /protein_id="ABA50549.1"
FT                   /translation="MRCRSSCGSAAPRVYGAAGAADEAKGAIGVGSDMADYRRIGKPSL
FT                   "
     atgcgctgcc ggagcagttg cggcagcgcc gcgccgcgcg tgtacggcgc ggcgggggcg        60
     gcggatgagg cgaaaggcgc gatcggcgtg ggctcggaca tggcggatta ccggcgaatc       120
     ggaaagccgt cattgtag                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page