(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE588

CP000124.PE588       Location/Qualifiers
FT   CDS_pept        complement(612200..612643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49714"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP2"
FT                   /protein_id="ABA49714.1"
FT                   /translation="MTIFDTNFRPPEENRKRFEVVGIQPIRPVKTTGVQRQPLETGSAR
FT                   PTYGATRPKAIAKRSAAMQMIYNSPNYCVVEFPPQDGHHAMNSGGYEIVDKNAQREIFI
FT                   DGELAARFREHVKQLIQAEPTLDEVDEFLGQFDSLMTQPVVLH"
     ttgacaatct ttgacaccaa ctttcgtcca ccggaggaga atcggaaacg ttttgaggtc        60
     gtcggcatcc aaccgatacg ccctgtaaaa acgaccggcg tgcagcgcca accccttgaa       120
     accggctcgg cccgccccac ttacggtgca acgaggccga aagccatagc aaagaggagt       180
     gccgccatgc aaatgatcta caacagcccc aactactgcg tcgtcgagtt cccgccgcag       240
     gacggccacc acgcgatgaa ttcgggtggc tacgaaatcg tcgacaagaa cgcgcagcgc       300
     gaaatcttca tcgacggcga actcgccgcg cgctttcgcg agcacgtgaa gcagttgatc       360
     caggccgagc cgacgctcga cgaggtcgac gaattcctcg gacagttcga cagcctgatg       420
     acgcaacccg tcgttctcca ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page