(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE589

CP000124.PE589       Location/Qualifiers
FT   CDS_pept        complement(612640..613959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49156"
FT                   /db_xref="GOA:Q3JWP1"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP1"
FT                   /protein_id="ABA49156.1"
FT                   /translation="MPLSSIVSSNPRGAARRVRRAACVLALVLALHWLAALWLVRFREP
FT                   FRPVEPDHVPVQVELLKPQPIERAPAPEKPAADRPRAAPKRAARAPAPPAHAPRASAPV
FT                   SSAAESSTESSAESPAAASGTEPASAAGGQAAGATSGAAAGASGASAPPGEAAQGVKFA
FT                   LPPSADLQYDTFYNGMQNMPGTIHWRTDGGGYSLYVSMPVPFVGPYTYESRGRVDAFGV
FT                   APARYVETRGRRPPDFAIFNRQTKQIVFTGTPNSLALPDGAQDRFSMLMQLAGLVGGDP
FT                   DAYRPGVTREFFVVDRDSGETWPITTIGDETISTGMGSLDARHFMRLPRRAGDTRRIDI
FT                   WLAPSLGWLPVRMVQTEPNGAQIELLLHRRTNANGDADVHSDTSANTDADANADGGAAP
FT                   AAAPASASGAPLNANEPVNSTEKADGSPRPPPADPGEPQP"
     atgccgttgt cgtccatcgt ttcgtcgaac ccgcgcggcg cggcgcgccg cgtgcgccgc        60
     gccgcgtgcg ttctcgcgct cgtgctggcg ctgcactggc tcgccgcgct gtggctcgtg       120
     cggtttcgcg agccgttcag gcccgtcgag cccgaccacg tgccggttca ggtcgaattg       180
     ctcaagccgc agccgatcga gcgcgcgccc gcgccggaga agcccgccgc cgatcggccg       240
     cgggccgcgc cgaagcgggc ggcccgcgcg cccgcgccgc ccgcgcatgc gccgcgcgcc       300
     tcggcgcccg tatcgagcgc cgctgaatcc tccaccgaat cctccgctga atcgcccgcc       360
     gccgcctccg gcaccgaacc ggcaagcgcg gcgggcgggc aggcggccgg cgcgacgagc       420
     ggcgcggccg ccggcgcatc gggcgcgagc gcgccgcccg gcgaagcagc gcagggcgtg       480
     aaattcgcgc tgccgccgtc cgccgatctg caatacgaca cgttctacaa cggcatgcaa       540
     aacatgcccg gcacgatcca ctggcgcacc gacggcggcg gctattcgtt atacgtatcg       600
     atgcccgtgc cgttcgtcgg cccgtacaca tacgaaagcc gcggccgcgt cgacgcgttc       660
     ggcgtcgcgc ctgcgcgcta tgtcgagacg cgcggccggc ggccgcccga tttcgcgatc       720
     ttcaatcggc agacgaagca aatcgtgttc accggcacgc cgaactcgct cgcgctgccc       780
     gacggcgcgc aggaccgctt cagcatgctg atgcaactcg cgggcctcgt cggcggcgat       840
     cccgatgcgt atcgcccggg cgtcacgcgc gagttcttcg tcgtcgatcg cgacagcggc       900
     gagacgtggc cgatcacgac gatcggcgac gagacgatct cgacgggcat gggctcgctc       960
     gatgctaggc atttcatgcg gctgccgcgc cgcgcgggcg acacgcgccg catcgacatc      1020
     tggctcgcgc cgtcgctcgg ctggctgccc gtgcggatgg ttcagacgga accgaacggc      1080
     gcgcagatcg aattgctgct gcaccggcgc acgaacgcaa acggcgatgc ggacgtacac      1140
     tcggatacga gcgcaaacac ggacgcagac gcgaacgccg acggcggcgc ggcgccggcc      1200
     gccgccccgg catccgcgtc cggcgcgccg ttgaacgcga acgagccggt aaattcgacc      1260
     gagaaggccg acggatcgcc gcgcccgccg ccggccgatc ccggagaacc gcaaccttga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page