(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE591

CP000124.PE591       Location/Qualifiers
FT   CDS_pept        complement(614038..614985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0599"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47728"
FT                   /db_xref="GOA:Q3JWN9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN9"
FT                   /protein_id="ABA47728.1"
FT                   /translation="MEGIYFTMVNPHGGPRREPPPPHSSRHAVNKSASPSSDAPDDDLA
FT                   DDHDTGEEKVRSGIQSIEVGFRLLDVLTGEPRAMMLRDLAQRAAMSPAKAHRYLVSFQR
FT                   LGLVSQDPVSGRYELGGFALQMGLARLARVDGVKLARIALTALRDQLDQTVGIAVWGNQ
FT                   GPTIVHWMESSHPAKASLKLGDVMPLLGSATGLVFAAYLPRGKTAAMIERELADTRRAA
FT                   HYTGPRTRAEVDAVLADVRAHRAARVEGMLLPTINAFGMPVFDAVGELALAIIALGHEG
FT                   AFDIRWGGEVDTALRTCAQKLSYELGYSEGARDA"
     atggaaggaa tctattttac gatggtgaat ccgcacggcg gcccgcgccg cgagccgccc        60
     cctccccatt cttcccgcca cgccgtgaac aagtccgcct cgccctcctc cgacgccccc       120
     gacgacgacc tcgccgacga tcacgacacc ggcgaggaaa aagtccgctc cggcatccag       180
     tcgatcgagg tcggctttcg cctgctcgac gtgctgacgg gcgagccgcg cgcgatgatg       240
     ctgcgcgacc tcgcgcagcg cgcggcgatg agcccggcga aggcgcaccg ctacctcgtc       300
     agtttccagc ggctcgggct cgtgtcgcag gatccggtgt cgggccgcta cgagctcggc       360
     ggcttcgcgt tgcagatggg cctggcgcgc ctcgcgcgcg tcgacggcgt gaagctcgcg       420
     cgcatcgcgc tcaccgcgct gcgcgatcag ctcgaccaga cggtcggcat cgcggtatgg       480
     ggcaaccagg ggccgacgat cgtccactgg atggagtcga gccatccggc gaaggcgtcg       540
     ctcaagctcg gcgacgtgat gccgctcctc ggctcggcga cgggcctcgt gttcgccgcg       600
     tacctgccgc gcggcaagac ggccgcgatg atcgagcgcg agctcgccga cacgcggcgc       660
     gccgcgcact ataccggccc gcgcacgcgc gccgaagtcg acgcggtgct cgccgacgtg       720
     cgcgcgcatc gcgcggcgcg cgtcgaaggc atgctgctgc cgacgatcaa cgcattcggg       780
     atgccggtgt tcgacgcggt cggcgagctc gcgctcgcga tcatcgcgct cggccacgag       840
     ggcgcgttcg acatccgctg gggcggcgag gtcgacaccg cgctgcgcac ctgcgcgcag       900
     aagctgtcgt acgagcttgg gtatagtgag ggagcgcgcg acgcctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page