(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE593

CP000124.PE593       Location/Qualifiers
FT   CDS_pept        615011..616003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0602"
FT                   /product="fumarylacetoacetate (FAA) hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47600"
FT                   /db_xref="GOA:Q3JWN7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN7"
FT                   /protein_id="ABA47600.1"
FT                   /translation="MKLASLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFY
FT                   APQLRDLYDALNHGRARNAFAFEPADCMAPLPRAFQWADGSAYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFLGPRDDIVCASEAWGIDFEAEVAVITADVPMGAAPDEALKAV
FT                   RLVTLVNDVSLRNLIPAELAKGFGFFQSKPASAFAPVAVTPDELGEHWREGRLHRPMLV
FT                   HWNGKKVGQPDAGVDMVFHFGQLIAHAAKTRNVRAGSIVGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIEHGAPQTEFMRYGDRVKIEMVDEAGKSIFGAIEQAVAPVDAAA"
     atgaaacttg cttcgctcaa ggacggcacg cgcgacggcc aactgatcgt cgtctcgcgc        60
     gacctgcaca cggcggcgat cgccgacgcg atcgcgccga cgctgcagcg cgtgctcgac       120
     gactgggcgt tctacgcgcc gcagctgcgc gacctgtacg acgcactgaa ccacggccgc       180
     gcgcgcaacg cgttcgcgtt cgagcccgcc gattgcatgg cgccgctgcc gcgcgcgttc       240
     cagtgggcgg acggctccgc gtacgtgaac cacgtcgagc tcgtgcgccg cgcgcgcggc       300
     gccgagatgc cgcccgagtt ctggaccgat ccgctgatgt accagggcgg cagcgacgat       360
     ttcctcggcc cgcgcgacga catcgtctgc gcatcggagg cgtggggcat cgatttcgag       420
     gcggaagtcg cggtgatcac ggccgacgtg ccgatgggcg ccgcgcccga cgaggcgctg       480
     aaagcggtgc ggctcgtcac gctcgtgaac gacgtgtcgc tgcgcaacct gattcccgcc       540
     gagctcgcga agggcttcgg cttcttccag agcaagccgg cgagcgcgtt cgcgccggtg       600
     gccgtgacgc ccgacgagct cggcgagcac tggcgcgaag gccgcctgca tcgcccgatg       660
     ctcgtccact ggaacggcaa gaaggtcggt cagccggatg cgggcgtcga catggtgttt       720
     cacttcggtc aactgatcgc gcacgcggcg aagacgcgca acgtgcgcgc gggctcgatc       780
     gtcggctcgg gcacggtgtc gaacaaggat gcgaagcgcg gctactgctg catcgccgag       840
     aagcgctgcc tcgagacgat cgagcacggc gcgccgcaga ccgagttcat gcgctacggc       900
     gacagggtga agatcgagat ggtcgacgag gcggggaagt cgatcttcgg cgcgatcgag       960
     caggcggtcg cgccggtgga cgccgccgct tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page